Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L757

Protein Details
Accession A0A015L757   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-188ELGYCRCKKRSYEKPIRKLKIILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006571  TLDc_dom  
PROSITE View protein in PROSITE  
PS51886  TLDC  
Amino Acid Sequences MDKVLPYKKILPKELYKDLLKSFLSLLKPNSKLSNNLNPHLTNLKAIDSKIITSQHNELISKWIDRLKISDKLASPYEFGLLLRGSRDGFARDKFHEISDGIPRTVTIVKVQGSNEILGGYNPNKWESDFVIEDHILSRVMNENFAIKNGSICGPSFGNGDLIIWELGYCRCKKRSYEKPIRKLKIILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.62
4 0.58
5 0.53
6 0.51
7 0.42
8 0.35
9 0.29
10 0.28
11 0.28
12 0.28
13 0.32
14 0.34
15 0.37
16 0.38
17 0.43
18 0.4
19 0.42
20 0.45
21 0.51
22 0.47
23 0.48
24 0.5
25 0.44
26 0.44
27 0.43
28 0.36
29 0.28
30 0.24
31 0.24
32 0.21
33 0.21
34 0.21
35 0.18
36 0.19
37 0.2
38 0.22
39 0.19
40 0.2
41 0.23
42 0.23
43 0.25
44 0.24
45 0.21
46 0.22
47 0.23
48 0.21
49 0.2
50 0.19
51 0.18
52 0.18
53 0.22
54 0.22
55 0.27
56 0.28
57 0.3
58 0.28
59 0.3
60 0.32
61 0.29
62 0.25
63 0.18
64 0.17
65 0.13
66 0.12
67 0.1
68 0.08
69 0.07
70 0.07
71 0.08
72 0.07
73 0.07
74 0.08
75 0.09
76 0.12
77 0.14
78 0.17
79 0.18
80 0.21
81 0.21
82 0.21
83 0.2
84 0.17
85 0.17
86 0.2
87 0.2
88 0.16
89 0.15
90 0.15
91 0.15
92 0.16
93 0.14
94 0.09
95 0.11
96 0.12
97 0.14
98 0.15
99 0.15
100 0.15
101 0.15
102 0.14
103 0.11
104 0.1
105 0.08
106 0.11
107 0.09
108 0.1
109 0.11
110 0.12
111 0.12
112 0.12
113 0.14
114 0.13
115 0.17
116 0.16
117 0.16
118 0.18
119 0.18
120 0.18
121 0.16
122 0.15
123 0.1
124 0.09
125 0.1
126 0.13
127 0.13
128 0.14
129 0.13
130 0.16
131 0.16
132 0.17
133 0.18
134 0.11
135 0.12
136 0.13
137 0.14
138 0.12
139 0.12
140 0.14
141 0.13
142 0.14
143 0.14
144 0.13
145 0.13
146 0.12
147 0.11
148 0.09
149 0.1
150 0.09
151 0.07
152 0.07
153 0.07
154 0.1
155 0.16
156 0.19
157 0.24
158 0.3
159 0.35
160 0.43
161 0.53
162 0.61
163 0.67
164 0.74
165 0.79
166 0.84
167 0.9
168 0.89
169 0.84