Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MA21

Protein Details
Accession A0A015MA21   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-94MLNRKAAARLRQKKKKEIKELQDSNIHydrophilic
NLS Segment(s)
PositionSequence
64-85NERKRMLNRKAAARLRQKKKKE
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
Amino Acid Sequences MEKKESYEISEDNPLLKTLVVSTKDSSSEDIQQNQSLCKISSSSSRSSKFSNNIDKKILQNERNERKRMLNRKAAARLRQKKKKEIKELQDSNIGLRDEIEQVESIIMKLRQQIMDLEIKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.19
4 0.15
5 0.11
6 0.17
7 0.18
8 0.2
9 0.22
10 0.23
11 0.24
12 0.25
13 0.26
14 0.22
15 0.26
16 0.27
17 0.3
18 0.3
19 0.31
20 0.31
21 0.29
22 0.28
23 0.22
24 0.19
25 0.15
26 0.14
27 0.12
28 0.19
29 0.22
30 0.27
31 0.32
32 0.34
33 0.35
34 0.37
35 0.41
36 0.39
37 0.43
38 0.48
39 0.46
40 0.47
41 0.48
42 0.47
43 0.43
44 0.46
45 0.45
46 0.39
47 0.41
48 0.47
49 0.55
50 0.59
51 0.6
52 0.54
53 0.55
54 0.6
55 0.63
56 0.61
57 0.59
58 0.57
59 0.62
60 0.69
61 0.67
62 0.66
63 0.67
64 0.7
65 0.72
66 0.77
67 0.76
68 0.78
69 0.82
70 0.84
71 0.84
72 0.83
73 0.82
74 0.83
75 0.82
76 0.75
77 0.71
78 0.61
79 0.51
80 0.46
81 0.37
82 0.25
83 0.21
84 0.2
85 0.15
86 0.15
87 0.15
88 0.1
89 0.1
90 0.11
91 0.1
92 0.09
93 0.12
94 0.12
95 0.13
96 0.17
97 0.21
98 0.21
99 0.23
100 0.24
101 0.24
102 0.31