Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JW22

Protein Details
Accession A0A015JW22    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
325-349GSPAEMKVRRKLKKKVEASSSKSSKHydrophilic
NLS Segment(s)
PositionSequence
332-339VRRKLKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, golg 3, cyto 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR032852  ALKBH2  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
Gene Ontology GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
Amino Acid Sequences MDLDDPNSDNNENMEIDSDTCNTCKQQFFPIYNSWMCLESSCKSFWKIWNTVKMSWENAPQDLSFNPIFLVPGFISGEILSRPLPFSIIPSPPIGHNNIGAYSLMHWKGYHCLRCGRVSCRVKWSCWECMNCHKTLSALKTILDKSMLADPHRLVFTGPATDCEGSILNGSNITRDRTILSNGVILMKYNFPNDNRIFHFVSNEICNEMPDIFLKNFQEIDNEQLKRHPIKSKLETRLFARQFTLNVGEHYKFALELNTVPWKDAPKVCNDTLDYVKKIIENFVPEVSHDFNQMLVAIYMEGQRMSWHDDGEKGVGPIIVSLSLGSPAEMKVRRKLKKKVEASSSKSSKNDEKGDYTPTFPIMRRNGPELLLNLNHGDIVIMAGDTLQEHYDHMVAPKGFRVACTIRKIEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.16
4 0.17
5 0.18
6 0.16
7 0.17
8 0.19
9 0.2
10 0.24
11 0.27
12 0.27
13 0.35
14 0.42
15 0.44
16 0.48
17 0.51
18 0.52
19 0.48
20 0.48
21 0.4
22 0.33
23 0.29
24 0.25
25 0.23
26 0.19
27 0.21
28 0.22
29 0.23
30 0.25
31 0.3
32 0.36
33 0.41
34 0.47
35 0.52
36 0.59
37 0.62
38 0.62
39 0.62
40 0.59
41 0.53
42 0.48
43 0.48
44 0.4
45 0.36
46 0.35
47 0.29
48 0.28
49 0.24
50 0.25
51 0.18
52 0.16
53 0.15
54 0.13
55 0.13
56 0.11
57 0.14
58 0.09
59 0.11
60 0.12
61 0.11
62 0.11
63 0.11
64 0.12
65 0.09
66 0.1
67 0.09
68 0.09
69 0.1
70 0.09
71 0.11
72 0.1
73 0.14
74 0.18
75 0.2
76 0.21
77 0.22
78 0.23
79 0.24
80 0.27
81 0.25
82 0.21
83 0.2
84 0.2
85 0.18
86 0.18
87 0.16
88 0.13
89 0.12
90 0.17
91 0.16
92 0.15
93 0.15
94 0.15
95 0.22
96 0.29
97 0.32
98 0.3
99 0.35
100 0.38
101 0.45
102 0.49
103 0.46
104 0.5
105 0.51
106 0.51
107 0.56
108 0.56
109 0.5
110 0.54
111 0.54
112 0.52
113 0.52
114 0.52
115 0.45
116 0.53
117 0.55
118 0.47
119 0.44
120 0.35
121 0.31
122 0.33
123 0.32
124 0.27
125 0.24
126 0.24
127 0.28
128 0.28
129 0.27
130 0.22
131 0.19
132 0.15
133 0.19
134 0.2
135 0.16
136 0.18
137 0.17
138 0.19
139 0.19
140 0.18
141 0.13
142 0.13
143 0.13
144 0.14
145 0.14
146 0.13
147 0.15
148 0.15
149 0.15
150 0.14
151 0.13
152 0.09
153 0.1
154 0.09
155 0.07
156 0.08
157 0.08
158 0.09
159 0.1
160 0.12
161 0.11
162 0.11
163 0.13
164 0.13
165 0.15
166 0.14
167 0.14
168 0.13
169 0.13
170 0.13
171 0.12
172 0.1
173 0.09
174 0.1
175 0.11
176 0.11
177 0.14
178 0.13
179 0.2
180 0.22
181 0.25
182 0.25
183 0.29
184 0.28
185 0.26
186 0.26
187 0.2
188 0.2
189 0.18
190 0.15
191 0.12
192 0.1
193 0.1
194 0.1
195 0.09
196 0.07
197 0.07
198 0.09
199 0.08
200 0.1
201 0.11
202 0.11
203 0.12
204 0.11
205 0.13
206 0.12
207 0.17
208 0.21
209 0.22
210 0.21
211 0.22
212 0.26
213 0.27
214 0.31
215 0.32
216 0.31
217 0.39
218 0.47
219 0.54
220 0.59
221 0.61
222 0.59
223 0.57
224 0.6
225 0.53
226 0.46
227 0.39
228 0.31
229 0.27
230 0.26
231 0.26
232 0.17
233 0.17
234 0.19
235 0.18
236 0.17
237 0.16
238 0.14
239 0.1
240 0.1
241 0.1
242 0.07
243 0.07
244 0.1
245 0.16
246 0.16
247 0.16
248 0.18
249 0.19
250 0.22
251 0.26
252 0.25
253 0.26
254 0.32
255 0.32
256 0.34
257 0.33
258 0.33
259 0.35
260 0.37
261 0.31
262 0.26
263 0.26
264 0.24
265 0.24
266 0.22
267 0.18
268 0.18
269 0.18
270 0.19
271 0.18
272 0.17
273 0.19
274 0.2
275 0.18
276 0.15
277 0.14
278 0.12
279 0.12
280 0.12
281 0.1
282 0.07
283 0.06
284 0.05
285 0.06
286 0.07
287 0.07
288 0.07
289 0.06
290 0.07
291 0.08
292 0.13
293 0.14
294 0.14
295 0.14
296 0.16
297 0.18
298 0.19
299 0.19
300 0.14
301 0.14
302 0.13
303 0.12
304 0.11
305 0.1
306 0.07
307 0.06
308 0.06
309 0.06
310 0.06
311 0.06
312 0.06
313 0.07
314 0.07
315 0.14
316 0.19
317 0.23
318 0.3
319 0.4
320 0.49
321 0.57
322 0.67
323 0.71
324 0.76
325 0.82
326 0.82
327 0.83
328 0.85
329 0.83
330 0.83
331 0.78
332 0.73
333 0.67
334 0.63
335 0.6
336 0.58
337 0.58
338 0.52
339 0.52
340 0.49
341 0.54
342 0.5
343 0.45
344 0.39
345 0.35
346 0.33
347 0.29
348 0.35
349 0.34
350 0.4
351 0.41
352 0.44
353 0.43
354 0.41
355 0.44
356 0.37
357 0.36
358 0.29
359 0.27
360 0.23
361 0.21
362 0.19
363 0.15
364 0.13
365 0.08
366 0.07
367 0.05
368 0.04
369 0.04
370 0.04
371 0.05
372 0.05
373 0.06
374 0.07
375 0.07
376 0.07
377 0.09
378 0.1
379 0.12
380 0.13
381 0.18
382 0.19
383 0.2
384 0.22
385 0.26
386 0.25
387 0.25
388 0.31
389 0.31
390 0.37
391 0.44