Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K1Y9

Protein Details
Accession J3K1Y9   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKTPKLKSNRTKSVRSRAARRDASPHydrophilic
54-78HVAGVSKKKQKRQTRAQRLRQEKGLHydrophilic
NLS Segment(s)
PositionSequence
60-78KKKQKRQTRAQRLRQEKGL
89-105EKKVAKSMNRGKVVKAR
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG cim:CIMG_09262  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MKTPKLKSNRTKSVRSRAARRDASPSVDVDKSIASLPRAERTVLTRPSVLGAQHVAGVSKKKQKRQTRAQRLRQEKGLERAEIVMDKTEKKVAKSMNRGKVVKARKATWDDLNKRGTNAYKILQDQGPDAMDTSDNERQPKQRKPAVSSVNPPQLAQPAQTEQFDFELDGEIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.83
4 0.81
5 0.84
6 0.81
7 0.74
8 0.71
9 0.64
10 0.61
11 0.53
12 0.45
13 0.4
14 0.34
15 0.31
16 0.23
17 0.2
18 0.16
19 0.15
20 0.16
21 0.12
22 0.16
23 0.17
24 0.21
25 0.22
26 0.22
27 0.21
28 0.24
29 0.32
30 0.31
31 0.31
32 0.27
33 0.26
34 0.27
35 0.28
36 0.23
37 0.16
38 0.13
39 0.11
40 0.12
41 0.12
42 0.11
43 0.1
44 0.14
45 0.17
46 0.26
47 0.3
48 0.37
49 0.47
50 0.57
51 0.65
52 0.73
53 0.8
54 0.82
55 0.88
56 0.9
57 0.9
58 0.88
59 0.82
60 0.76
61 0.7
62 0.62
63 0.59
64 0.51
65 0.42
66 0.34
67 0.3
68 0.25
69 0.21
70 0.17
71 0.11
72 0.09
73 0.1
74 0.1
75 0.14
76 0.15
77 0.15
78 0.19
79 0.23
80 0.3
81 0.4
82 0.48
83 0.52
84 0.58
85 0.58
86 0.55
87 0.58
88 0.57
89 0.53
90 0.49
91 0.42
92 0.42
93 0.47
94 0.48
95 0.48
96 0.51
97 0.49
98 0.5
99 0.55
100 0.48
101 0.44
102 0.44
103 0.38
104 0.31
105 0.3
106 0.27
107 0.25
108 0.26
109 0.28
110 0.26
111 0.24
112 0.22
113 0.2
114 0.18
115 0.14
116 0.13
117 0.11
118 0.1
119 0.1
120 0.15
121 0.19
122 0.21
123 0.23
124 0.27
125 0.34
126 0.42
127 0.5
128 0.54
129 0.55
130 0.6
131 0.64
132 0.7
133 0.71
134 0.7
135 0.68
136 0.68
137 0.69
138 0.63
139 0.56
140 0.49
141 0.45
142 0.39
143 0.34
144 0.29
145 0.26
146 0.28
147 0.29
148 0.28
149 0.24
150 0.24
151 0.23
152 0.19
153 0.14