Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JP24

Protein Details
Accession A0A015JP24    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
226-249GYAYHEKKWKRCCAKFKEGNKITIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, nucl 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001870  B30.2/SPRY  
IPR043136  B30.2/SPRY_sf  
IPR013320  ConA-like_dom_sf  
PROSITE View protein in PROSITE  
PS50188  B302_SPRY  
Amino Acid Sequences MSQVLINWVAKNKLENSEIDSLSLKGLKYFLEKTYDTQIPFATPEFNIWEYTLAKFIRKVIQNETIIERILDKKSFSMCEPQEIEGIKNHSTPLIKFINLKRMDGEEIEQHVEPFGTYPTQELKKSYSSILNGRELGFIRGVPIFRWKNNGSSLKISVDGFTVEGNGLVKPKSVLGNLIFKGKGVYEWNILIEKLNNKVYIGICDINVNLNENDKVYHGWVLGSDGYAYHEKKWKRCCAKFKEGNKITIHLDMKNKTCAFSINNNKKFVVSGWQNIPSQVYPIASLGHTSKLRIEPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.33
4 0.37
5 0.36
6 0.33
7 0.3
8 0.25
9 0.25
10 0.26
11 0.2
12 0.14
13 0.15
14 0.15
15 0.19
16 0.22
17 0.22
18 0.26
19 0.27
20 0.29
21 0.36
22 0.38
23 0.34
24 0.32
25 0.3
26 0.26
27 0.26
28 0.24
29 0.18
30 0.14
31 0.15
32 0.18
33 0.18
34 0.18
35 0.17
36 0.19
37 0.17
38 0.18
39 0.21
40 0.18
41 0.19
42 0.19
43 0.22
44 0.27
45 0.32
46 0.35
47 0.36
48 0.43
49 0.43
50 0.44
51 0.45
52 0.38
53 0.32
54 0.29
55 0.24
56 0.2
57 0.21
58 0.2
59 0.17
60 0.19
61 0.22
62 0.23
63 0.23
64 0.28
65 0.26
66 0.31
67 0.32
68 0.31
69 0.31
70 0.3
71 0.29
72 0.24
73 0.26
74 0.21
75 0.19
76 0.18
77 0.18
78 0.18
79 0.18
80 0.2
81 0.19
82 0.19
83 0.24
84 0.27
85 0.34
86 0.33
87 0.34
88 0.29
89 0.29
90 0.29
91 0.24
92 0.23
93 0.16
94 0.17
95 0.19
96 0.17
97 0.15
98 0.13
99 0.12
100 0.11
101 0.08
102 0.07
103 0.05
104 0.05
105 0.07
106 0.12
107 0.15
108 0.16
109 0.17
110 0.19
111 0.21
112 0.22
113 0.23
114 0.21
115 0.21
116 0.25
117 0.27
118 0.26
119 0.25
120 0.24
121 0.24
122 0.21
123 0.19
124 0.15
125 0.11
126 0.1
127 0.1
128 0.1
129 0.08
130 0.16
131 0.17
132 0.18
133 0.24
134 0.23
135 0.25
136 0.32
137 0.36
138 0.3
139 0.31
140 0.32
141 0.27
142 0.27
143 0.24
144 0.18
145 0.14
146 0.11
147 0.09
148 0.07
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.09
160 0.08
161 0.11
162 0.12
163 0.18
164 0.19
165 0.22
166 0.2
167 0.19
168 0.19
169 0.16
170 0.16
171 0.12
172 0.14
173 0.13
174 0.13
175 0.14
176 0.14
177 0.14
178 0.13
179 0.13
180 0.14
181 0.16
182 0.18
183 0.17
184 0.16
185 0.19
186 0.19
187 0.19
188 0.2
189 0.17
190 0.14
191 0.15
192 0.15
193 0.14
194 0.14
195 0.14
196 0.11
197 0.13
198 0.13
199 0.13
200 0.13
201 0.12
202 0.12
203 0.11
204 0.12
205 0.1
206 0.1
207 0.1
208 0.11
209 0.1
210 0.1
211 0.08
212 0.07
213 0.1
214 0.14
215 0.15
216 0.17
217 0.24
218 0.29
219 0.36
220 0.46
221 0.53
222 0.6
223 0.68
224 0.75
225 0.78
226 0.84
227 0.87
228 0.86
229 0.87
230 0.81
231 0.79
232 0.7
233 0.64
234 0.55
235 0.52
236 0.46
237 0.39
238 0.41
239 0.4
240 0.41
241 0.46
242 0.44
243 0.38
244 0.36
245 0.35
246 0.33
247 0.38
248 0.46
249 0.49
250 0.55
251 0.57
252 0.56
253 0.53
254 0.49
255 0.4
256 0.39
257 0.33
258 0.34
259 0.37
260 0.42
261 0.42
262 0.42
263 0.43
264 0.34
265 0.3
266 0.25
267 0.2
268 0.16
269 0.17
270 0.18
271 0.14
272 0.17
273 0.16
274 0.21
275 0.21
276 0.21
277 0.26
278 0.33