Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I9XMI6

Protein Details
Accession I9XMI6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-133AHNLQQRGLKQRRRKKNILRPLSEPHydrophilic
NLS Segment(s)
PositionSequence
118-125KQRRRKKN
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
KEGG cim:CIMG_13636  -  
cim:CIMG_13638  -  
Amino Acid Sequences MGKLLPRLKDKDLLGFGKSISRLRSVKRQPELDGSTTEKACASYESYLQRKGTKKLIGQRQPGPHAASDISSDQLADPTHLLPTYTLRTLVRVELKVYRWNYRKVIEDAHNLQQRGLKQRRRKKNILRPLSEPVRGDLRTWRVPPDQCAVTPGPGARALWSRCAMTPGPVRGNPRTWRACPLEQMRDNPRTSAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.34
4 0.32
5 0.33
6 0.28
7 0.24
8 0.28
9 0.31
10 0.35
11 0.45
12 0.5
13 0.58
14 0.62
15 0.64
16 0.61
17 0.65
18 0.65
19 0.56
20 0.5
21 0.45
22 0.41
23 0.37
24 0.34
25 0.25
26 0.21
27 0.19
28 0.17
29 0.15
30 0.13
31 0.18
32 0.24
33 0.27
34 0.31
35 0.32
36 0.38
37 0.39
38 0.42
39 0.45
40 0.44
41 0.47
42 0.51
43 0.6
44 0.62
45 0.64
46 0.66
47 0.65
48 0.63
49 0.6
50 0.52
51 0.42
52 0.35
53 0.29
54 0.22
55 0.18
56 0.15
57 0.12
58 0.1
59 0.1
60 0.08
61 0.09
62 0.09
63 0.07
64 0.07
65 0.07
66 0.08
67 0.07
68 0.08
69 0.06
70 0.09
71 0.11
72 0.1
73 0.12
74 0.11
75 0.13
76 0.14
77 0.16
78 0.17
79 0.15
80 0.16
81 0.18
82 0.2
83 0.25
84 0.26
85 0.31
86 0.31
87 0.35
88 0.36
89 0.35
90 0.38
91 0.34
92 0.37
93 0.33
94 0.35
95 0.34
96 0.39
97 0.4
98 0.36
99 0.35
100 0.32
101 0.31
102 0.36
103 0.41
104 0.41
105 0.48
106 0.58
107 0.68
108 0.75
109 0.82
110 0.83
111 0.85
112 0.88
113 0.88
114 0.82
115 0.75
116 0.75
117 0.69
118 0.62
119 0.51
120 0.43
121 0.39
122 0.35
123 0.31
124 0.29
125 0.31
126 0.33
127 0.34
128 0.36
129 0.37
130 0.38
131 0.41
132 0.4
133 0.36
134 0.3
135 0.34
136 0.3
137 0.25
138 0.25
139 0.22
140 0.18
141 0.17
142 0.17
143 0.15
144 0.21
145 0.21
146 0.24
147 0.26
148 0.25
149 0.25
150 0.29
151 0.27
152 0.26
153 0.32
154 0.33
155 0.37
156 0.39
157 0.45
158 0.45
159 0.53
160 0.52
161 0.54
162 0.56
163 0.52
164 0.57
165 0.58
166 0.58
167 0.59
168 0.62
169 0.63
170 0.61
171 0.66
172 0.66
173 0.66
174 0.63