Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MG32

Protein Details
Accession A0A015MG32    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ESVSPSPSSKRNKRNSSFDSPSHydrophilic
68-109TDSRDERRGRSRTRKGNRSCDKRSNRSYSRDHKRKSVREGIKBasic
NLS Segment(s)
PositionSequence
17-104KRNKRNSSFDSPSPGRKKTPDIDDKRRSRHSSETRGKSSGRINEKRSRDSSTDSRDERRGRSRTRKGNRSCDKRSNRSYSRDHKRKSV
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSHKKRNESVSPSPSSKRNKRNSSFDSPSPGRKKTPDIDDKRRSRHSSETRGKSSGRINEKRSRDSSTDSRDERRGRSRTRKGNRSCDKRSNRSYSRDHKRKSVREGIKIENSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.66
4 0.67
5 0.69
6 0.74
7 0.77
8 0.83
9 0.83
10 0.82
11 0.79
12 0.71
13 0.7
14 0.62
15 0.64
16 0.6
17 0.55
18 0.49
19 0.46
20 0.49
21 0.47
22 0.53
23 0.54
24 0.57
25 0.65
26 0.71
27 0.75
28 0.76
29 0.77
30 0.71
31 0.65
32 0.66
33 0.64
34 0.65
35 0.68
36 0.68
37 0.63
38 0.62
39 0.58
40 0.51
41 0.48
42 0.44
43 0.44
44 0.42
45 0.45
46 0.5
47 0.54
48 0.55
49 0.53
50 0.5
51 0.43
52 0.43
53 0.44
54 0.43
55 0.46
56 0.44
57 0.45
58 0.47
59 0.49
60 0.48
61 0.5
62 0.51
63 0.54
64 0.62
65 0.68
66 0.72
67 0.79
68 0.83
69 0.83
70 0.86
71 0.88
72 0.86
73 0.85
74 0.85
75 0.85
76 0.84
77 0.85
78 0.84
79 0.8
80 0.78
81 0.79
82 0.79
83 0.81
84 0.81
85 0.77
86 0.77
87 0.81
88 0.81
89 0.81
90 0.81
91 0.78
92 0.78
93 0.8
94 0.78