Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015IK56

Protein Details
Accession A0A015IK56    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-32RERGHPLHVARKRRERRDETLKAMBasic
NLS Segment(s)
PositionSequence
18-24ARKRRER
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MMIWMERERERGHPLHVARKRRERRDETLKAMNNHHAVVEEIGLRDLHPSDKDLSTSSCAGLSIDRIRGEGDATAWTQGLSCLSGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.52
4 0.57
5 0.6
6 0.68
7 0.75
8 0.77
9 0.83
10 0.8
11 0.81
12 0.83
13 0.81
14 0.77
15 0.76
16 0.71
17 0.64
18 0.59
19 0.55
20 0.45
21 0.38
22 0.31
23 0.22
24 0.17
25 0.14
26 0.12
27 0.08
28 0.06
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.08
37 0.11
38 0.11
39 0.12
40 0.13
41 0.14
42 0.16
43 0.16
44 0.14
45 0.12
46 0.11
47 0.11
48 0.1
49 0.12
50 0.12
51 0.15
52 0.15
53 0.15
54 0.16
55 0.16
56 0.16
57 0.13
58 0.11
59 0.1
60 0.11
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.1
67 0.08