Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JT29

Protein Details
Accession A0A0D8JT29    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-61THLANKGKKKVRRRKSSQMPASRVRSHydrophilic
NLS Segment(s)
PositionSequence
41-58KGKKKVRRRKSSQMPASR
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
KEGG cim:CIMG_12743  -  
Amino Acid Sequences MSWNVRVLSCFEAQPSPHSGATPFKNDVSIACLPGTHLANKGKKKVRRRKSSQMPASRVRSLRAKGVQALQDLKYRVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.24
4 0.23
5 0.23
6 0.22
7 0.26
8 0.28
9 0.3
10 0.28
11 0.24
12 0.25
13 0.24
14 0.23
15 0.22
16 0.19
17 0.15
18 0.13
19 0.13
20 0.12
21 0.15
22 0.15
23 0.11
24 0.14
25 0.19
26 0.25
27 0.28
28 0.36
29 0.41
30 0.47
31 0.58
32 0.64
33 0.69
34 0.74
35 0.8
36 0.83
37 0.87
38 0.9
39 0.89
40 0.88
41 0.84
42 0.81
43 0.78
44 0.73
45 0.63
46 0.56
47 0.53
48 0.46
49 0.48
50 0.45
51 0.42
52 0.4
53 0.44
54 0.44
55 0.41
56 0.43
57 0.37
58 0.38
59 0.36