Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MXP5

Protein Details
Accession A0A015MXP5   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-84QPINKNKTSTVKKQKKSQKPLKTITNCYQEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, cyto 7, cyto_pero 4.333
Family & Domain DBs
Amino Acid Sequences MDGNIGDEFDSPQDETIEEDDTNIPETISLGDKLDKCLHKTLRDFIENKPLDIFQPINKNKTSTVKKQKKSQKPLKTITNCYQEQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.14
5 0.12
6 0.13
7 0.13
8 0.13
9 0.15
10 0.13
11 0.11
12 0.09
13 0.09
14 0.09
15 0.1
16 0.1
17 0.08
18 0.12
19 0.12
20 0.16
21 0.21
22 0.22
23 0.23
24 0.29
25 0.32
26 0.34
27 0.36
28 0.38
29 0.37
30 0.39
31 0.39
32 0.33
33 0.4
34 0.35
35 0.33
36 0.29
37 0.24
38 0.2
39 0.21
40 0.2
41 0.14
42 0.24
43 0.27
44 0.29
45 0.3
46 0.31
47 0.32
48 0.41
49 0.44
50 0.45
51 0.54
52 0.6
53 0.67
54 0.75
55 0.82
56 0.84
57 0.88
58 0.88
59 0.87
60 0.86
61 0.88
62 0.89
63 0.86
64 0.84
65 0.82
66 0.8