Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L9L3

Protein Details
Accession A0A015L9L3   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-28KLGKHLTKRIAKKPVAKKPKLTCTLDHydrophilic
31-51TFNNCEKLKRYKKLKEHPYFQHydrophilic
NLS Segment(s)
PositionSequence
8-22LTKRIAKKPVAKKPK
Subcellular Location(s) nucl 15, mito_nucl 13.5, mito 10
Family & Domain DBs
Amino Acid Sequences MVKLGKHLTKRIAKKPVAKKPKLTCTLDDITFNNCEKLKRYKKLKEHPYFQEVIDENTVRCMCNKEIKLDKTYHVHNLDNYSKNKWCKFTAQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.81
4 0.83
5 0.8
6 0.8
7 0.8
8 0.83
9 0.81
10 0.74
11 0.66
12 0.62
13 0.6
14 0.52
15 0.45
16 0.35
17 0.3
18 0.29
19 0.27
20 0.22
21 0.19
22 0.19
23 0.2
24 0.3
25 0.37
26 0.43
27 0.52
28 0.58
29 0.67
30 0.77
31 0.84
32 0.81
33 0.79
34 0.75
35 0.7
36 0.62
37 0.52
38 0.47
39 0.37
40 0.31
41 0.26
42 0.21
43 0.16
44 0.19
45 0.19
46 0.13
47 0.14
48 0.16
49 0.16
50 0.24
51 0.26
52 0.3
53 0.38
54 0.42
55 0.45
56 0.44
57 0.46
58 0.42
59 0.44
60 0.44
61 0.39
62 0.38
63 0.37
64 0.42
65 0.45
66 0.47
67 0.46
68 0.45
69 0.48
70 0.54
71 0.57
72 0.54
73 0.51