Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KBE4

Protein Details
Accession A0A015KBE4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-94TRNVFNKKKRSAKNIYNYLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 13, cyto 12
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVFVELHNKILDGEKILKEKTLEVSRVEYEILDSHYPLGEALEKKLAELKSIHPTQTAKILLNVEIKRQFPSDMTRNVFNKKKRSAKNIYNYLLASVCCANAKIFYCGILQVFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.28
4 0.29
5 0.27
6 0.28
7 0.31
8 0.32
9 0.3
10 0.28
11 0.31
12 0.3
13 0.3
14 0.28
15 0.2
16 0.15
17 0.14
18 0.15
19 0.12
20 0.11
21 0.11
22 0.11
23 0.11
24 0.09
25 0.09
26 0.1
27 0.1
28 0.11
29 0.15
30 0.14
31 0.15
32 0.2
33 0.19
34 0.16
35 0.17
36 0.2
37 0.23
38 0.25
39 0.25
40 0.22
41 0.23
42 0.22
43 0.25
44 0.23
45 0.16
46 0.17
47 0.17
48 0.17
49 0.23
50 0.23
51 0.21
52 0.23
53 0.24
54 0.23
55 0.23
56 0.22
57 0.17
58 0.23
59 0.25
60 0.28
61 0.3
62 0.35
63 0.37
64 0.44
65 0.49
66 0.5
67 0.53
68 0.56
69 0.63
70 0.64
71 0.71
72 0.74
73 0.76
74 0.8
75 0.8
76 0.74
77 0.67
78 0.6
79 0.52
80 0.44
81 0.34
82 0.25
83 0.16
84 0.14
85 0.12
86 0.12
87 0.11
88 0.14
89 0.16
90 0.17
91 0.17
92 0.18
93 0.18
94 0.19
95 0.2