Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LVG7

Protein Details
Accession A0A015LVG7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-69GSTEPKKRSGRPKVLTERDTRBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13384  HTH_23  
Amino Acid Sequences MRGKEVSKTHWERIIGAYLSGIRQRVISTQFGIPTSTVNDIIKKYKETGSTEPKKRSGRPKVLTERDTRALKCII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.34
3 0.27
4 0.23
5 0.19
6 0.19
7 0.19
8 0.17
9 0.11
10 0.11
11 0.11
12 0.14
13 0.16
14 0.16
15 0.16
16 0.17
17 0.18
18 0.18
19 0.18
20 0.15
21 0.12
22 0.12
23 0.11
24 0.11
25 0.1
26 0.11
27 0.12
28 0.16
29 0.17
30 0.17
31 0.18
32 0.2
33 0.24
34 0.28
35 0.34
36 0.41
37 0.49
38 0.56
39 0.59
40 0.64
41 0.65
42 0.67
43 0.71
44 0.71
45 0.72
46 0.71
47 0.76
48 0.79
49 0.82
50 0.81
51 0.76
52 0.72
53 0.69
54 0.68
55 0.58