Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LS95

Protein Details
Accession A0A015LS95    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-102KVMGSKRKTKHRGPFNSNTCFNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 8, E.R. 6, mito 4
Family & Domain DBs
Amino Acid Sequences MKLSIPLTIVAIICIIALEQIEAFNTTLGIFVFFSQCKVWATDNFGNTVMDTGWLNCEDGDPNPTYHIREITANPYWLHAKVMGSKRKTKHRGPFNSNTCFNFGGNVFKWHFDQYNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.07
17 0.06
18 0.06
19 0.09
20 0.09
21 0.1
22 0.1
23 0.12
24 0.12
25 0.14
26 0.15
27 0.15
28 0.23
29 0.26
30 0.26
31 0.26
32 0.26
33 0.23
34 0.21
35 0.19
36 0.11
37 0.08
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.09
49 0.09
50 0.11
51 0.11
52 0.12
53 0.13
54 0.13
55 0.12
56 0.14
57 0.15
58 0.18
59 0.2
60 0.2
61 0.19
62 0.2
63 0.21
64 0.19
65 0.18
66 0.15
67 0.14
68 0.2
69 0.28
70 0.34
71 0.37
72 0.45
73 0.5
74 0.6
75 0.66
76 0.68
77 0.69
78 0.73
79 0.78
80 0.8
81 0.84
82 0.81
83 0.82
84 0.77
85 0.69
86 0.62
87 0.53
88 0.43
89 0.36
90 0.29
91 0.28
92 0.25
93 0.29
94 0.27
95 0.27
96 0.3
97 0.31