Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KD22

Protein Details
Accession A0A015KD22    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-98FIGKTLPKINKSKKKITRTCLLVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MLENRHFLDTIPIFNEDDENIYTYIPPNDSNEKSRIDYIWASLPILGQSLNSTVIENDHFTTDHNTVTLSLDTQLFIGKTLPKINKSKKKITRTCLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.15
4 0.16
5 0.14
6 0.14
7 0.12
8 0.12
9 0.12
10 0.12
11 0.14
12 0.12
13 0.12
14 0.15
15 0.21
16 0.24
17 0.27
18 0.29
19 0.3
20 0.31
21 0.31
22 0.27
23 0.24
24 0.21
25 0.19
26 0.2
27 0.17
28 0.15
29 0.14
30 0.14
31 0.1
32 0.1
33 0.08
34 0.04
35 0.04
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.13
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.12
55 0.12
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.08
63 0.08
64 0.1
65 0.11
66 0.14
67 0.22
68 0.26
69 0.32
70 0.42
71 0.53
72 0.61
73 0.66
74 0.75
75 0.77
76 0.83
77 0.86
78 0.83