Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MCA3

Protein Details
Accession A0A015MCA3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-86KDTKRYSRVKVKNDNSSWRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MEKEIFRLKETIDKSIVIFLEKDGDVCWKNYIGRETKKTEKLSYPTLKKNEYLDMVKMFGENQSVYKDTKRYSRVKVKNDNSSWRKVFKEVEKWRRAQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.28
4 0.21
5 0.19
6 0.14
7 0.16
8 0.15
9 0.15
10 0.11
11 0.16
12 0.15
13 0.16
14 0.17
15 0.15
16 0.17
17 0.19
18 0.25
19 0.28
20 0.33
21 0.38
22 0.43
23 0.48
24 0.54
25 0.55
26 0.53
27 0.51
28 0.48
29 0.51
30 0.53
31 0.51
32 0.51
33 0.52
34 0.5
35 0.46
36 0.44
37 0.37
38 0.32
39 0.28
40 0.23
41 0.2
42 0.19
43 0.17
44 0.15
45 0.12
46 0.1
47 0.1
48 0.08
49 0.08
50 0.1
51 0.11
52 0.13
53 0.15
54 0.18
55 0.19
56 0.27
57 0.33
58 0.37
59 0.45
60 0.55
61 0.61
62 0.68
63 0.76
64 0.77
65 0.8
66 0.8
67 0.81
68 0.75
69 0.75
70 0.7
71 0.64
72 0.59
73 0.53
74 0.55
75 0.53
76 0.59
77 0.61
78 0.67
79 0.71