Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MK00

Protein Details
Accession A0A015MK00   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-114VEITSTREKKRKKTRTIKPATKPKTESLHydrophilic
NLS Segment(s)
PositionSequence
93-111REKKRKKTRTIKPATKPKT
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDSMESQRLSYERVNSRLFFQNKENFDPVNKTFAGTRHNNNFNRRTNPKFMNYVVQRRYRDPLAEIFMNTYQQEDSFIMIDTEAVAVEITSTREKKRKKTRTIKPATKPKTESLLKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.44
4 0.5
5 0.48
6 0.43
7 0.43
8 0.46
9 0.46
10 0.5
11 0.48
12 0.39
13 0.39
14 0.42
15 0.36
16 0.32
17 0.28
18 0.23
19 0.23
20 0.25
21 0.29
22 0.27
23 0.33
24 0.36
25 0.45
26 0.5
27 0.55
28 0.6
29 0.6
30 0.64
31 0.64
32 0.61
33 0.59
34 0.58
35 0.55
36 0.51
37 0.46
38 0.47
39 0.45
40 0.48
41 0.46
42 0.48
43 0.46
44 0.44
45 0.47
46 0.39
47 0.35
48 0.28
49 0.25
50 0.22
51 0.21
52 0.18
53 0.17
54 0.16
55 0.16
56 0.14
57 0.12
58 0.09
59 0.08
60 0.1
61 0.08
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.05
69 0.05
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.04
76 0.06
77 0.11
78 0.14
79 0.2
80 0.28
81 0.35
82 0.45
83 0.56
84 0.65
85 0.71
86 0.8
87 0.85
88 0.89
89 0.93
90 0.93
91 0.92
92 0.93
93 0.89
94 0.88
95 0.81
96 0.75
97 0.74
98 0.68