Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LGK7

Protein Details
Accession A0A015LGK7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
143-169RPIYHIITSRWPRRRRWQGPRGTDRGAHydrophilic
NLS Segment(s)
PositionSequence
156-158RRR
Subcellular Location(s) cyto 12, cyto_nucl 8.5, pero 5, extr 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045146  SF3A1  
IPR000061  Surp  
IPR035967  SWAP/Surp_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0045292  P:mRNA cis splicing, via spliceosome  
Pfam View protein in Pfam  
PF01805  Surp  
PROSITE View protein in PROSITE  
PS50128  SURP  
Amino Acid Sequences MAANGTNGDSAAVLDEIKAPAGVVLPPREIRNILEKTAGYVARNGAVFEDRIRDKENGNPKFSFLNPEDAYHQYYQWRLVEVRAGRGTDIAAGSGHHSPDGSLCGKEWAPVHDPARPARGWQPPISIPHSQPYIPQLFPAHHRPIYHIITSRWPRRRRWQGPRGTDRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.09
5 0.09
6 0.07
7 0.07
8 0.08
9 0.1
10 0.12
11 0.14
12 0.17
13 0.19
14 0.21
15 0.23
16 0.23
17 0.24
18 0.29
19 0.29
20 0.27
21 0.29
22 0.27
23 0.27
24 0.31
25 0.3
26 0.21
27 0.2
28 0.19
29 0.18
30 0.18
31 0.16
32 0.12
33 0.12
34 0.12
35 0.11
36 0.16
37 0.14
38 0.16
39 0.2
40 0.2
41 0.2
42 0.27
43 0.36
44 0.36
45 0.39
46 0.38
47 0.36
48 0.37
49 0.36
50 0.34
51 0.26
52 0.29
53 0.25
54 0.26
55 0.27
56 0.27
57 0.29
58 0.24
59 0.23
60 0.17
61 0.17
62 0.18
63 0.16
64 0.16
65 0.13
66 0.13
67 0.17
68 0.16
69 0.19
70 0.18
71 0.17
72 0.15
73 0.15
74 0.15
75 0.11
76 0.1
77 0.06
78 0.05
79 0.05
80 0.07
81 0.08
82 0.08
83 0.07
84 0.07
85 0.06
86 0.07
87 0.1
88 0.09
89 0.09
90 0.09
91 0.11
92 0.12
93 0.14
94 0.14
95 0.15
96 0.17
97 0.22
98 0.23
99 0.24
100 0.26
101 0.26
102 0.3
103 0.26
104 0.26
105 0.28
106 0.34
107 0.35
108 0.35
109 0.37
110 0.36
111 0.4
112 0.43
113 0.39
114 0.33
115 0.33
116 0.34
117 0.3
118 0.28
119 0.29
120 0.29
121 0.25
122 0.26
123 0.24
124 0.23
125 0.28
126 0.34
127 0.35
128 0.34
129 0.34
130 0.37
131 0.42
132 0.44
133 0.44
134 0.41
135 0.36
136 0.44
137 0.52
138 0.57
139 0.6
140 0.61
141 0.65
142 0.72
143 0.82
144 0.82
145 0.84
146 0.85
147 0.86
148 0.91
149 0.92