Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015J811

Protein Details
Accession A0A015J811    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-128RRENEKKEMERRDKERREKERREKERRERNRREKDKEQEKNENDESBasic
NLS Segment(s)
PositionSequence
81-118KERRENEKKEMERRDKERREKERREKERRERNRREKDK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTKRRGVTGKDKATKAAKTTKTIRTYVANSSRDYNKERDERREEGSEQDVDIGEGNNRQDDDIERIILDMLPEQEERNIEKERRENEKKEMERRDKERREKERREKERRERNRREKDKEQEKNENDESDKNIKSEHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.57
4 0.52
5 0.51
6 0.58
7 0.6
8 0.59
9 0.57
10 0.54
11 0.5
12 0.48
13 0.5
14 0.52
15 0.45
16 0.41
17 0.44
18 0.46
19 0.44
20 0.45
21 0.4
22 0.39
23 0.46
24 0.49
25 0.53
26 0.55
27 0.54
28 0.55
29 0.55
30 0.48
31 0.43
32 0.41
33 0.32
34 0.26
35 0.23
36 0.18
37 0.13
38 0.13
39 0.09
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.13
49 0.12
50 0.12
51 0.11
52 0.11
53 0.11
54 0.1
55 0.09
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.13
65 0.16
66 0.17
67 0.21
68 0.27
69 0.31
70 0.4
71 0.46
72 0.46
73 0.5
74 0.58
75 0.6
76 0.63
77 0.68
78 0.68
79 0.69
80 0.73
81 0.77
82 0.77
83 0.81
84 0.83
85 0.83
86 0.85
87 0.88
88 0.91
89 0.91
90 0.92
91 0.93
92 0.93
93 0.93
94 0.94
95 0.94
96 0.94
97 0.94
98 0.94
99 0.95
100 0.94
101 0.93
102 0.92
103 0.92
104 0.91
105 0.9
106 0.88
107 0.87
108 0.81
109 0.8
110 0.74
111 0.67
112 0.59
113 0.52
114 0.49
115 0.46
116 0.43
117 0.35