Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IAM7

Protein Details
Accession A0A015IAM7   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-28TKVMERQDKSKSSKKRKYSEGQSNMDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007021  DUF659  
Pfam View protein in Pfam  
PF04937  DUF659  
Amino Acid Sequences MTKVMERQDKSKSSKKRKYSEGQSNMDDYHDLTELNEQRCKRTNRALVKFFIACGIAFRIVEHPFFINFIKELNAGYNTPTREVLVNQLLERELAQVNFKVNSELEKEMNLMLAFDGWMSGTHRSIWNFIVMISLRKEYLYQLFDLSKNSHTAEYLVTVIEKVIEGIGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.82
4 0.84
5 0.86
6 0.88
7 0.88
8 0.86
9 0.82
10 0.74
11 0.68
12 0.59
13 0.49
14 0.39
15 0.28
16 0.21
17 0.15
18 0.12
19 0.1
20 0.17
21 0.22
22 0.24
23 0.29
24 0.27
25 0.32
26 0.4
27 0.45
28 0.44
29 0.48
30 0.54
31 0.59
32 0.68
33 0.68
34 0.62
35 0.61
36 0.55
37 0.45
38 0.37
39 0.26
40 0.17
41 0.14
42 0.13
43 0.1
44 0.09
45 0.1
46 0.12
47 0.12
48 0.13
49 0.12
50 0.11
51 0.11
52 0.12
53 0.12
54 0.1
55 0.09
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.13
65 0.13
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.14
72 0.13
73 0.14
74 0.13
75 0.13
76 0.12
77 0.12
78 0.11
79 0.09
80 0.07
81 0.07
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.09
89 0.11
90 0.13
91 0.14
92 0.13
93 0.13
94 0.14
95 0.12
96 0.13
97 0.11
98 0.08
99 0.06
100 0.06
101 0.05
102 0.04
103 0.04
104 0.03
105 0.04
106 0.06
107 0.07
108 0.08
109 0.1
110 0.13
111 0.15
112 0.16
113 0.16
114 0.17
115 0.15
116 0.14
117 0.17
118 0.14
119 0.16
120 0.16
121 0.17
122 0.15
123 0.15
124 0.16
125 0.15
126 0.2
127 0.19
128 0.18
129 0.2
130 0.22
131 0.23
132 0.26
133 0.26
134 0.22
135 0.22
136 0.23
137 0.21
138 0.19
139 0.19
140 0.17
141 0.17
142 0.15
143 0.13
144 0.12
145 0.11
146 0.1
147 0.1
148 0.08
149 0.07
150 0.06