Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015NCP2

Protein Details
Accession A0A015NCP2    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22PSLLRSRRFHQPFRFPHSKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004323  Ion_tolerance_CutA  
IPR011322  N-reg_PII-like_a/b  
IPR015867  N-reg_PII/ATP_PRibTrfase_C  
Gene Ontology GO:0010038  P:response to metal ion  
Pfam View protein in Pfam  
PF03091  CutA1  
Amino Acid Sequences MIPSLLRSRRFHQPFRFPHSKPLTLRLFTFTLLLTHLSPRLFSTTLACAAPSLKTVMESAAASRIVYVTCPNAEVANKLSRGLLQEKLVACVNIIPQVTSLYWWEGKIEESTEQLLMIKTLEKHVSELTDYVNKNHGYEVPEVLSVKIDAGNESYLKWIKDSVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.82
4 0.72
5 0.75
6 0.74
7 0.72
8 0.64
9 0.64
10 0.61
11 0.54
12 0.54
13 0.48
14 0.41
15 0.33
16 0.31
17 0.23
18 0.16
19 0.15
20 0.15
21 0.11
22 0.12
23 0.14
24 0.13
25 0.13
26 0.14
27 0.17
28 0.16
29 0.15
30 0.16
31 0.16
32 0.18
33 0.18
34 0.16
35 0.13
36 0.13
37 0.13
38 0.11
39 0.09
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.08
46 0.08
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.08
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.09
61 0.09
62 0.11
63 0.14
64 0.14
65 0.13
66 0.13
67 0.13
68 0.15
69 0.17
70 0.15
71 0.13
72 0.16
73 0.16
74 0.18
75 0.17
76 0.14
77 0.12
78 0.11
79 0.1
80 0.1
81 0.1
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.1
88 0.09
89 0.1
90 0.1
91 0.1
92 0.09
93 0.1
94 0.11
95 0.11
96 0.1
97 0.1
98 0.11
99 0.11
100 0.1
101 0.1
102 0.09
103 0.08
104 0.07
105 0.09
106 0.08
107 0.12
108 0.14
109 0.14
110 0.15
111 0.16
112 0.17
113 0.16
114 0.16
115 0.16
116 0.21
117 0.21
118 0.21
119 0.26
120 0.25
121 0.24
122 0.25
123 0.25
124 0.22
125 0.23
126 0.24
127 0.2
128 0.21
129 0.21
130 0.2
131 0.18
132 0.15
133 0.13
134 0.13
135 0.12
136 0.1
137 0.12
138 0.14
139 0.13
140 0.14
141 0.19
142 0.2
143 0.2
144 0.2
145 0.24