Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MDB6

Protein Details
Accession A0A015MDB6   
Localization Confidence High
Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-93VRIPPAKRPGRKRKITQLSDHydrophilic
NLS Segment(s)
PositionSequence
78-87PAKRPGRKRK
168-178PAKRPGRKTKA
200-204KRPGR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MNQINNITTNQTEPLLVSNSPNIESLERLDNNKSLPKLLEAVDVSPAYSKRPGHKHRITQSSDKEEAIEDVEVVRIPPAKRPGRKRKITQLSDDEKGVEDVETIRIPPAKCPGRKTKAAQPPDDEKGVEDVEVVRIPPAKCPGRKRKITQLSNDEKGVEDVETIRIPPAKRPGRKTKAAQPPNDEKGVEDAETIRIPPAKRPGRKCKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.18
6 0.19
7 0.2
8 0.2
9 0.19
10 0.17
11 0.17
12 0.19
13 0.23
14 0.24
15 0.25
16 0.27
17 0.28
18 0.3
19 0.34
20 0.32
21 0.27
22 0.26
23 0.25
24 0.25
25 0.23
26 0.25
27 0.2
28 0.2
29 0.21
30 0.2
31 0.18
32 0.18
33 0.17
34 0.15
35 0.19
36 0.21
37 0.26
38 0.37
39 0.44
40 0.52
41 0.6
42 0.67
43 0.71
44 0.78
45 0.75
46 0.74
47 0.74
48 0.71
49 0.64
50 0.54
51 0.46
52 0.37
53 0.32
54 0.24
55 0.17
56 0.09
57 0.07
58 0.07
59 0.07
60 0.06
61 0.07
62 0.09
63 0.09
64 0.14
65 0.23
66 0.31
67 0.39
68 0.5
69 0.6
70 0.67
71 0.75
72 0.77
73 0.79
74 0.82
75 0.78
76 0.74
77 0.72
78 0.66
79 0.59
80 0.53
81 0.42
82 0.32
83 0.28
84 0.21
85 0.12
86 0.07
87 0.06
88 0.07
89 0.06
90 0.06
91 0.07
92 0.1
93 0.1
94 0.11
95 0.19
96 0.25
97 0.27
98 0.33
99 0.42
100 0.45
101 0.51
102 0.54
103 0.55
104 0.58
105 0.61
106 0.59
107 0.54
108 0.54
109 0.5
110 0.47
111 0.37
112 0.28
113 0.25
114 0.22
115 0.16
116 0.11
117 0.08
118 0.09
119 0.09
120 0.08
121 0.07
122 0.11
123 0.11
124 0.14
125 0.22
126 0.27
127 0.33
128 0.43
129 0.53
130 0.59
131 0.67
132 0.7
133 0.74
134 0.78
135 0.79
136 0.78
137 0.77
138 0.75
139 0.71
140 0.65
141 0.55
142 0.44
143 0.38
144 0.3
145 0.19
146 0.12
147 0.09
148 0.09
149 0.09
150 0.08
151 0.08
152 0.11
153 0.12
154 0.17
155 0.27
156 0.35
157 0.43
158 0.52
159 0.63
160 0.68
161 0.76
162 0.77
163 0.77
164 0.79
165 0.8
166 0.78
167 0.75
168 0.76
169 0.73
170 0.69
171 0.58
172 0.48
173 0.44
174 0.4
175 0.31
176 0.23
177 0.19
178 0.18
179 0.19
180 0.18
181 0.17
182 0.19
183 0.19
184 0.25
185 0.35
186 0.41
187 0.5
188 0.6
189 0.68