Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JFR9

Protein Details
Accession A0A015JFR9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-97HLSRHVQSCQSKRNRKENEKPVHPPSPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MIAVPFKNLSTLYIRDQVQNEGNNSSSPSSRTITTYIFTESTTSHPNSSWQKPFNCSINGCTKSFTRHGHLSRHVQSCQSKRNRKENEKPVHPPSPVTSCIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.35
5 0.35
6 0.36
7 0.33
8 0.29
9 0.29
10 0.25
11 0.25
12 0.22
13 0.18
14 0.16
15 0.17
16 0.17
17 0.17
18 0.18
19 0.19
20 0.19
21 0.19
22 0.18
23 0.17
24 0.16
25 0.15
26 0.14
27 0.12
28 0.14
29 0.16
30 0.16
31 0.15
32 0.14
33 0.2
34 0.25
35 0.3
36 0.32
37 0.33
38 0.34
39 0.36
40 0.39
41 0.38
42 0.35
43 0.3
44 0.28
45 0.33
46 0.34
47 0.32
48 0.31
49 0.28
50 0.29
51 0.33
52 0.33
53 0.29
54 0.34
55 0.38
56 0.43
57 0.48
58 0.52
59 0.55
60 0.56
61 0.52
62 0.5
63 0.54
64 0.54
65 0.58
66 0.6
67 0.63
68 0.66
69 0.76
70 0.81
71 0.83
72 0.87
73 0.88
74 0.88
75 0.87
76 0.87
77 0.84
78 0.81
79 0.71
80 0.64
81 0.59
82 0.54