Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q1EAH9

Protein Details
Accession Q1EAH9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
255-282NIEKPPDLRDIRKKVREQKKAAKEAVIKHydrophilic
NLS Segment(s)
PositionSequence
266-278RKKVREQKKAAKE
Subcellular Location(s) mito 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
IPR027540  Coq4_euk  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0006744  P:ubiquinone biosynthetic process  
KEGG cim:CIMG_00434  -  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MAIAKSVRARAVGLRSLRVLCAQRSVAREFSVLNRPQPNYPGHIPLTPIERGALAIGSAVGSLLNPRRGDLIATVGETTATPFFIYRLRDAMLADPTGRRILRDRPRITSQTLSLPYLRSLPKNTVGYTYATWLDREGVSPDTRSSVQYIDDEECAYVMQRYRECHDFYHAVTGLPIVVEGEIALKAFEFMNTLIPMTGLSVFAAIRLKPEEKQRFWSIHLPWAIRSGLASKELINVYWEEQLERDVNELREELNIEKPPDLRDIRKKVREQKKAAKEAVIKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.36
4 0.36
5 0.36
6 0.34
7 0.28
8 0.31
9 0.32
10 0.34
11 0.37
12 0.4
13 0.36
14 0.34
15 0.33
16 0.28
17 0.3
18 0.35
19 0.34
20 0.37
21 0.41
22 0.42
23 0.44
24 0.47
25 0.44
26 0.41
27 0.41
28 0.4
29 0.36
30 0.35
31 0.35
32 0.32
33 0.34
34 0.28
35 0.25
36 0.19
37 0.16
38 0.15
39 0.14
40 0.11
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.03
48 0.03
49 0.07
50 0.11
51 0.16
52 0.16
53 0.16
54 0.18
55 0.19
56 0.2
57 0.17
58 0.18
59 0.14
60 0.14
61 0.14
62 0.12
63 0.12
64 0.11
65 0.11
66 0.07
67 0.07
68 0.06
69 0.06
70 0.07
71 0.11
72 0.13
73 0.13
74 0.14
75 0.15
76 0.16
77 0.16
78 0.18
79 0.16
80 0.15
81 0.15
82 0.13
83 0.13
84 0.16
85 0.16
86 0.14
87 0.16
88 0.25
89 0.34
90 0.44
91 0.46
92 0.48
93 0.54
94 0.56
95 0.56
96 0.49
97 0.41
98 0.38
99 0.37
100 0.32
101 0.27
102 0.24
103 0.22
104 0.23
105 0.23
106 0.18
107 0.19
108 0.21
109 0.25
110 0.27
111 0.27
112 0.24
113 0.24
114 0.23
115 0.21
116 0.2
117 0.16
118 0.14
119 0.14
120 0.12
121 0.12
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.11
128 0.11
129 0.12
130 0.12
131 0.12
132 0.12
133 0.1
134 0.11
135 0.11
136 0.13
137 0.12
138 0.11
139 0.11
140 0.1
141 0.09
142 0.08
143 0.07
144 0.07
145 0.07
146 0.1
147 0.12
148 0.14
149 0.18
150 0.22
151 0.23
152 0.23
153 0.26
154 0.25
155 0.23
156 0.27
157 0.24
158 0.2
159 0.19
160 0.17
161 0.13
162 0.1
163 0.1
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.04
171 0.04
172 0.03
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.08
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.05
187 0.05
188 0.06
189 0.05
190 0.07
191 0.09
192 0.08
193 0.09
194 0.13
195 0.15
196 0.17
197 0.28
198 0.36
199 0.38
200 0.45
201 0.48
202 0.48
203 0.51
204 0.55
205 0.47
206 0.44
207 0.46
208 0.4
209 0.35
210 0.36
211 0.32
212 0.24
213 0.22
214 0.18
215 0.15
216 0.16
217 0.16
218 0.13
219 0.17
220 0.18
221 0.17
222 0.16
223 0.15
224 0.15
225 0.18
226 0.18
227 0.14
228 0.14
229 0.17
230 0.17
231 0.16
232 0.17
233 0.17
234 0.18
235 0.19
236 0.19
237 0.17
238 0.17
239 0.19
240 0.18
241 0.21
242 0.24
243 0.24
244 0.27
245 0.28
246 0.28
247 0.34
248 0.38
249 0.4
250 0.46
251 0.55
252 0.63
253 0.71
254 0.78
255 0.81
256 0.86
257 0.88
258 0.88
259 0.88
260 0.88
261 0.89
262 0.83
263 0.8