Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KZM8

Protein Details
Accession A0A015KZM8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-44GNGKWLSTRKTFKKHQKREKANIEKINEHydrophilic
NLS Segment(s)
PositionSequence
29-33KKHQK
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MPFLCSCRICKINSKDGNGKWLSTRKTFKKHQKREKANIEKINESEAESGSETKSDSESISSCNAAEKRKFEDDESDKSDTSSESNISNNDHVPVILKDIPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.61
4 0.66
5 0.57
6 0.51
7 0.46
8 0.47
9 0.44
10 0.43
11 0.51
12 0.51
13 0.58
14 0.67
15 0.72
16 0.76
17 0.83
18 0.86
19 0.88
20 0.9
21 0.91
22 0.93
23 0.92
24 0.89
25 0.85
26 0.77
27 0.69
28 0.59
29 0.51
30 0.4
31 0.3
32 0.22
33 0.15
34 0.13
35 0.11
36 0.11
37 0.09
38 0.09
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.07
45 0.08
46 0.09
47 0.1
48 0.1
49 0.09
50 0.13
51 0.16
52 0.19
53 0.22
54 0.23
55 0.28
56 0.33
57 0.34
58 0.31
59 0.38
60 0.39
61 0.42
62 0.44
63 0.41
64 0.36
65 0.35
66 0.34
67 0.25
68 0.22
69 0.17
70 0.14
71 0.12
72 0.14
73 0.16
74 0.19
75 0.2
76 0.19
77 0.19
78 0.18
79 0.16
80 0.17
81 0.16
82 0.19
83 0.21