Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K210

Protein Details
Accession J3K210    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MDSQGLRPKKTKRKGVPTISLHTRHydrophilic
NLS Segment(s)
PositionSequence
9-14KKTKRK
52-56GRRPK
Subcellular Location(s) mito 13.5, mito_nucl 11.833, nucl 9, cyto_nucl 7.333
Family & Domain DBs
KEGG cim:CIMG_09285  -  
Amino Acid Sequences MDSQGLRPKKTKRKGVPTISLHTRSNAYFYNLPHHKILSQMWIIHHRHNLKGRRPKKFAIHEEFPVAPVANSYVIRKKGTVFLGGGSVLPARRFLGDNRNSESATLCDHVLRTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.84
5 0.82
6 0.79
7 0.73
8 0.63
9 0.54
10 0.47
11 0.38
12 0.35
13 0.28
14 0.25
15 0.24
16 0.24
17 0.32
18 0.32
19 0.34
20 0.32
21 0.31
22 0.26
23 0.26
24 0.26
25 0.21
26 0.21
27 0.2
28 0.21
29 0.27
30 0.29
31 0.29
32 0.34
33 0.31
34 0.34
35 0.41
36 0.46
37 0.48
38 0.57
39 0.61
40 0.65
41 0.67
42 0.67
43 0.67
44 0.69
45 0.68
46 0.65
47 0.61
48 0.53
49 0.51
50 0.46
51 0.38
52 0.3
53 0.21
54 0.13
55 0.09
56 0.09
57 0.08
58 0.09
59 0.1
60 0.15
61 0.18
62 0.19
63 0.2
64 0.2
65 0.24
66 0.25
67 0.25
68 0.2
69 0.18
70 0.18
71 0.18
72 0.16
73 0.11
74 0.11
75 0.09
76 0.09
77 0.1
78 0.1
79 0.11
80 0.13
81 0.16
82 0.25
83 0.32
84 0.36
85 0.41
86 0.43
87 0.41
88 0.4
89 0.39
90 0.29
91 0.26
92 0.23
93 0.18
94 0.16