Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KY47

Protein Details
Accession A0A015KY47   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-116NTKKSGKSDKNLNRNQPKKKNKPSSLKAVSKIHydrophilic
NLS Segment(s)
PositionSequence
72-121KKAQSKPKAKNTLNTKKSGKSDKNLNRNQPKKKNKPSSLKAVSKIITRRR
Subcellular Location(s) nucl 13.5, mito_nucl 13.166, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MATLWMDRKPCEFLIKCDASSFKIIQTSKGRRKLVAYFENWETTLRALDTPQFFVPDGKELKWCRHSIPTLKKAQSKPKAKNTLNTKKSGKSDKNLNRNQPKKKNKPSSLKAVSKIITRRRNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.42
4 0.4
5 0.4
6 0.33
7 0.35
8 0.3
9 0.22
10 0.26
11 0.26
12 0.3
13 0.39
14 0.46
15 0.52
16 0.6
17 0.6
18 0.55
19 0.59
20 0.58
21 0.57
22 0.53
23 0.47
24 0.42
25 0.42
26 0.42
27 0.38
28 0.33
29 0.24
30 0.18
31 0.15
32 0.11
33 0.1
34 0.09
35 0.12
36 0.13
37 0.14
38 0.14
39 0.14
40 0.14
41 0.15
42 0.15
43 0.15
44 0.15
45 0.14
46 0.19
47 0.2
48 0.24
49 0.28
50 0.28
51 0.26
52 0.3
53 0.33
54 0.36
55 0.45
56 0.48
57 0.51
58 0.55
59 0.6
60 0.6
61 0.67
62 0.67
63 0.67
64 0.68
65 0.71
66 0.77
67 0.72
68 0.75
69 0.75
70 0.76
71 0.71
72 0.7
73 0.64
74 0.59
75 0.64
76 0.66
77 0.61
78 0.56
79 0.63
80 0.65
81 0.72
82 0.74
83 0.78
84 0.79
85 0.82
86 0.86
87 0.86
88 0.88
89 0.88
90 0.91
91 0.92
92 0.91
93 0.93
94 0.89
95 0.9
96 0.88
97 0.85
98 0.78
99 0.74
100 0.66
101 0.62
102 0.64
103 0.63