Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L4F2

Protein Details
Accession A0A015L4F2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-80PCKPTAPEKSGNKKVKRKRYPPRSVNVKSTKYHydrophilic
NLS Segment(s)
PositionSequence
57-71KSGNKKVKRKRYPPR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MRSVDRVVVFEKIRALEERLDVIDNRLDTLFSSFYCSSESSSSESDYEPCKPTAPEKSGNKKVKRKRYPPRSVNVKSTKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.2
4 0.21
5 0.21
6 0.19
7 0.2
8 0.18
9 0.17
10 0.17
11 0.15
12 0.14
13 0.13
14 0.11
15 0.1
16 0.12
17 0.11
18 0.08
19 0.14
20 0.13
21 0.13
22 0.15
23 0.15
24 0.15
25 0.15
26 0.16
27 0.13
28 0.13
29 0.14
30 0.13
31 0.13
32 0.13
33 0.14
34 0.16
35 0.16
36 0.15
37 0.16
38 0.16
39 0.21
40 0.27
41 0.3
42 0.36
43 0.43
44 0.53
45 0.62
46 0.71
47 0.76
48 0.78
49 0.83
50 0.85
51 0.87
52 0.88
53 0.89
54 0.91
55 0.93
56 0.91
57 0.92
58 0.91
59 0.87
60 0.87