Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KDX6

Protein Details
Accession A0A015KDX6    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-86KQIINKAKKHLPTKKPHPNKDNLPEAVHydrophilic
NLS Segment(s)
PositionSequence
67-69KKH
73-73K
Subcellular Location(s) nucl 21.5, mito_nucl 12, cyto 2
Family & Domain DBs
Amino Acid Sequences MAMNRRYKVEKVIDYSKITDDQWKTFTEQSELILEEELKMLKIEECPTTTILNRIWNSIKQIINKAKKHLPTKKPHPNKDNLPEAVFFYKKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.46
4 0.39
5 0.34
6 0.35
7 0.31
8 0.29
9 0.28
10 0.28
11 0.29
12 0.29
13 0.3
14 0.25
15 0.22
16 0.2
17 0.2
18 0.19
19 0.16
20 0.14
21 0.12
22 0.09
23 0.09
24 0.08
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.09
31 0.1
32 0.11
33 0.12
34 0.13
35 0.14
36 0.13
37 0.14
38 0.14
39 0.2
40 0.19
41 0.21
42 0.22
43 0.22
44 0.26
45 0.29
46 0.31
47 0.27
48 0.35
49 0.42
50 0.49
51 0.51
52 0.53
53 0.53
54 0.58
55 0.65
56 0.67
57 0.68
58 0.69
59 0.77
60 0.82
61 0.87
62 0.89
63 0.87
64 0.86
65 0.86
66 0.84
67 0.82
68 0.74
69 0.66
70 0.57
71 0.53
72 0.5
73 0.43