Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JU04

Protein Details
Accession A0A015JU04   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
50-69TILMKKTTTHHRKRMNFELTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.833, cyto 5.5, cyto_pero 4.666, pero 2.5
Family & Domain DBs
Amino Acid Sequences MVRYRDLLNLTENHTLSWIDLYNQHLVEINDAPNDLIEPAVDDIQEVMVTILMKKTTTHHRKRMNFELTGCYWLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.19
4 0.18
5 0.14
6 0.09
7 0.12
8 0.14
9 0.16
10 0.16
11 0.16
12 0.16
13 0.16
14 0.17
15 0.16
16 0.14
17 0.11
18 0.11
19 0.11
20 0.08
21 0.08
22 0.06
23 0.04
24 0.03
25 0.04
26 0.04
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.04
36 0.04
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.12
43 0.22
44 0.33
45 0.43
46 0.51
47 0.61
48 0.7
49 0.78
50 0.84
51 0.79
52 0.73
53 0.66
54 0.63
55 0.55