Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015J906

Protein Details
Accession A0A015J906    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
309-332ICNSCPQKSCYKCKLRSYVHYVVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MNNNDNDNNNNNNNNDNNDNDDNTKNNENTKPHFITFPYEIIVDICRYIDIYSLRSLAISCKGLVFVQRYPPLWRNIHFTTPEEHKRIEKEYLSNLQYISSIPQKLRRIDDKCIKNLINMLKKYNLLDAVNTINLDFTSINCTSIWESINGFPNLEEISLRGCSCLSLRELGTALTWFEPFQPILKLNKLRVLWCKDMDTRSLMSQNLNIDSGVSYYKFVYVELSRALKTLNTENSIQLDIDLCKKCRENITFTMECGNCLIQNNFCMSCDLDKGCLECYTFYCNEEKCLNSSNRIIKECDICHVDALICNSCPQKSCYKCKLRSYVHYVVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.36
4 0.38
5 0.36
6 0.37
7 0.36
8 0.36
9 0.34
10 0.35
11 0.39
12 0.34
13 0.38
14 0.42
15 0.45
16 0.48
17 0.54
18 0.54
19 0.49
20 0.5
21 0.44
22 0.44
23 0.4
24 0.36
25 0.28
26 0.23
27 0.22
28 0.2
29 0.2
30 0.15
31 0.12
32 0.1
33 0.09
34 0.1
35 0.09
36 0.13
37 0.13
38 0.14
39 0.16
40 0.17
41 0.16
42 0.16
43 0.16
44 0.15
45 0.18
46 0.17
47 0.15
48 0.15
49 0.16
50 0.16
51 0.2
52 0.21
53 0.2
54 0.26
55 0.3
56 0.31
57 0.37
58 0.41
59 0.44
60 0.44
61 0.43
62 0.43
63 0.42
64 0.46
65 0.43
66 0.39
67 0.37
68 0.41
69 0.46
70 0.42
71 0.41
72 0.38
73 0.39
74 0.42
75 0.42
76 0.37
77 0.34
78 0.36
79 0.42
80 0.4
81 0.37
82 0.33
83 0.28
84 0.25
85 0.22
86 0.19
87 0.16
88 0.17
89 0.17
90 0.25
91 0.3
92 0.34
93 0.39
94 0.45
95 0.45
96 0.52
97 0.6
98 0.58
99 0.57
100 0.59
101 0.54
102 0.46
103 0.47
104 0.46
105 0.44
106 0.4
107 0.38
108 0.35
109 0.35
110 0.35
111 0.31
112 0.26
113 0.18
114 0.16
115 0.16
116 0.15
117 0.14
118 0.13
119 0.11
120 0.08
121 0.08
122 0.08
123 0.07
124 0.05
125 0.1
126 0.1
127 0.11
128 0.11
129 0.12
130 0.12
131 0.13
132 0.14
133 0.1
134 0.11
135 0.13
136 0.18
137 0.17
138 0.16
139 0.14
140 0.14
141 0.14
142 0.12
143 0.1
144 0.05
145 0.06
146 0.07
147 0.07
148 0.07
149 0.06
150 0.07
151 0.07
152 0.09
153 0.08
154 0.09
155 0.09
156 0.1
157 0.1
158 0.1
159 0.09
160 0.08
161 0.08
162 0.06
163 0.06
164 0.06
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.11
171 0.14
172 0.2
173 0.23
174 0.23
175 0.28
176 0.28
177 0.3
178 0.35
179 0.38
180 0.36
181 0.34
182 0.37
183 0.35
184 0.35
185 0.33
186 0.29
187 0.24
188 0.22
189 0.23
190 0.2
191 0.17
192 0.18
193 0.18
194 0.16
195 0.15
196 0.13
197 0.11
198 0.1
199 0.1
200 0.09
201 0.08
202 0.07
203 0.07
204 0.09
205 0.09
206 0.08
207 0.11
208 0.11
209 0.12
210 0.15
211 0.17
212 0.15
213 0.15
214 0.16
215 0.13
216 0.15
217 0.19
218 0.2
219 0.21
220 0.22
221 0.23
222 0.24
223 0.24
224 0.21
225 0.16
226 0.14
227 0.12
228 0.18
229 0.21
230 0.2
231 0.24
232 0.25
233 0.28
234 0.35
235 0.38
236 0.38
237 0.41
238 0.48
239 0.45
240 0.44
241 0.49
242 0.4
243 0.36
244 0.31
245 0.25
246 0.18
247 0.2
248 0.21
249 0.14
250 0.16
251 0.19
252 0.18
253 0.18
254 0.18
255 0.17
256 0.17
257 0.2
258 0.19
259 0.18
260 0.19
261 0.19
262 0.19
263 0.2
264 0.18
265 0.16
266 0.17
267 0.21
268 0.21
269 0.21
270 0.25
271 0.24
272 0.28
273 0.3
274 0.3
275 0.27
276 0.34
277 0.35
278 0.34
279 0.41
280 0.45
281 0.48
282 0.49
283 0.49
284 0.45
285 0.5
286 0.46
287 0.44
288 0.4
289 0.34
290 0.32
291 0.3
292 0.27
293 0.22
294 0.26
295 0.23
296 0.19
297 0.22
298 0.23
299 0.24
300 0.26
301 0.26
302 0.33
303 0.38
304 0.49
305 0.56
306 0.65
307 0.71
308 0.79
309 0.86
310 0.84
311 0.85
312 0.84