Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015J2Z2

Protein Details
Accession A0A015J2Z2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-92MLNRKAAARLRQKKKKEVKELQDSNIHydrophilic
NLS Segment(s)
PositionSequence
64-83RKKMLNRKAAARLRQKKKKE
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
Amino Acid Sequences MEKKESYEILEDNPILQTSVISTKNSSSKDIQQNQSFCKISSSSSSRSSIFSNNIDKKILQNERKKMLNRKAAARLRQKKKKEVKELQDSNISLRGEIEQVESIIMKLRQQIMGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.14
4 0.11
5 0.09
6 0.15
7 0.16
8 0.16
9 0.17
10 0.2
11 0.26
12 0.28
13 0.29
14 0.28
15 0.35
16 0.44
17 0.51
18 0.54
19 0.55
20 0.57
21 0.56
22 0.59
23 0.5
24 0.4
25 0.35
26 0.29
27 0.24
28 0.26
29 0.27
30 0.24
31 0.27
32 0.29
33 0.27
34 0.28
35 0.28
36 0.25
37 0.24
38 0.24
39 0.28
40 0.3
41 0.3
42 0.3
43 0.28
44 0.27
45 0.32
46 0.36
47 0.36
48 0.4
49 0.45
50 0.49
51 0.55
52 0.59
53 0.6
54 0.61
55 0.61
56 0.57
57 0.57
58 0.62
59 0.63
60 0.66
61 0.68
62 0.7
63 0.72
64 0.78
65 0.78
66 0.79
67 0.83
68 0.84
69 0.85
70 0.84
71 0.83
72 0.84
73 0.83
74 0.76
75 0.72
76 0.63
77 0.54
78 0.49
79 0.4
80 0.29
81 0.24
82 0.21
83 0.15
84 0.15
85 0.16
86 0.11
87 0.11
88 0.11
89 0.11
90 0.1
91 0.14
92 0.14
93 0.14
94 0.18
95 0.21