Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015IEI9

Protein Details
Accession A0A015IEI9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-77GYYVAKYYKKLKDKAKPSRSANMKHydrophilic
NLS Segment(s)
PositionSequence
66-70DKAKP
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MAQLILAQARIFFSSQAEPDCGSAQAGSCEALFCSDCGKPTASACRRCPMHIRGYYVAKYYKKLKDKAKPSRSANMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.17
5 0.16
6 0.17
7 0.18
8 0.15
9 0.13
10 0.11
11 0.1
12 0.09
13 0.09
14 0.08
15 0.07
16 0.06
17 0.06
18 0.07
19 0.07
20 0.06
21 0.08
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.12
28 0.22
29 0.27
30 0.34
31 0.35
32 0.41
33 0.42
34 0.44
35 0.49
36 0.44
37 0.47
38 0.44
39 0.47
40 0.45
41 0.48
42 0.47
43 0.44
44 0.46
45 0.38
46 0.38
47 0.41
48 0.45
49 0.49
50 0.55
51 0.62
52 0.65
53 0.75
54 0.81
55 0.84
56 0.84
57 0.82