Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L9X1

Protein Details
Accession A0A015L9X1   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-53DGFKRMKNWLRRLEKKNKKNPSPPLPPGHydrophilic
NLS Segment(s)
PositionSequence
29-48KRMKNWLRRLEKKNKKNPSP
Subcellular Location(s) mito 18, mito_nucl 13.833, nucl 7.5, cyto_nucl 5.166
Family & Domain DBs
Amino Acid Sequences MCPTSSGKIHTRIFHQPCFRLGSHRDGFKRMKNWLRRLEKKNKKNPSPPLPPGTRGGLWYYRDFHNIEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.57
3 0.51
4 0.49
5 0.51
6 0.46
7 0.42
8 0.39
9 0.41
10 0.38
11 0.43
12 0.41
13 0.42
14 0.46
15 0.45
16 0.46
17 0.45
18 0.49
19 0.51
20 0.57
21 0.61
22 0.67
23 0.71
24 0.75
25 0.79
26 0.81
27 0.83
28 0.85
29 0.85
30 0.84
31 0.84
32 0.85
33 0.84
34 0.83
35 0.79
36 0.77
37 0.71
38 0.65
39 0.59
40 0.53
41 0.44
42 0.36
43 0.35
44 0.32
45 0.32
46 0.33
47 0.34
48 0.31
49 0.34