Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KRY5

Protein Details
Accession A0A015KRY5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
57-82QTVIPKNSWKKDKQKARVTQDKQVKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 7.5, cyto_pero 4.5
Family & Domain DBs
Amino Acid Sequences MGDVTYNVSVTDDGLDESSEDEPDKDEDNIILGLQIPNPVDEMPPILPDVEMTPVDQTVIPKNSWKKDKQKARVTQDKQVKNQSTMVQKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.09
10 0.11
11 0.12
12 0.11
13 0.11
14 0.1
15 0.11
16 0.11
17 0.09
18 0.07
19 0.06
20 0.06
21 0.06
22 0.08
23 0.07
24 0.07
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.12
46 0.15
47 0.15
48 0.21
49 0.27
50 0.35
51 0.42
52 0.49
53 0.54
54 0.62
55 0.73
56 0.77
57 0.81
58 0.83
59 0.85
60 0.88
61 0.83
62 0.82
63 0.82
64 0.8
65 0.76
66 0.77
67 0.72
68 0.64
69 0.64
70 0.61