Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JGB2

Protein Details
Accession A0A015JGB2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-124TPNYYKRLQKSKENRVKENKVFGEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF09011  HMG_box_2  
Amino Acid Sequences MGKPKANKNHSKSRTPNAWILFSNNHHNGKIRKHGSKNVKRTDSMKSAQIEWENMSSNKKLDFFLQGETIKERTQVEEANKYLDDNEKLTPITHDRFIIITPNYYKRLQKSKENRVKENKVFGEFIQEDAYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.73
3 0.72
4 0.65
5 0.61
6 0.52
7 0.49
8 0.45
9 0.39
10 0.43
11 0.43
12 0.41
13 0.38
14 0.43
15 0.44
16 0.45
17 0.52
18 0.51
19 0.53
20 0.56
21 0.64
22 0.7
23 0.75
24 0.78
25 0.78
26 0.74
27 0.68
28 0.65
29 0.63
30 0.58
31 0.5
32 0.46
33 0.38
34 0.34
35 0.35
36 0.33
37 0.27
38 0.21
39 0.2
40 0.17
41 0.16
42 0.18
43 0.15
44 0.15
45 0.15
46 0.15
47 0.14
48 0.13
49 0.16
50 0.15
51 0.16
52 0.18
53 0.17
54 0.17
55 0.18
56 0.18
57 0.14
58 0.15
59 0.14
60 0.12
61 0.13
62 0.16
63 0.18
64 0.22
65 0.22
66 0.22
67 0.22
68 0.21
69 0.2
70 0.2
71 0.18
72 0.15
73 0.15
74 0.14
75 0.15
76 0.15
77 0.17
78 0.18
79 0.19
80 0.19
81 0.18
82 0.18
83 0.18
84 0.18
85 0.21
86 0.17
87 0.19
88 0.22
89 0.26
90 0.29
91 0.32
92 0.36
93 0.38
94 0.47
95 0.49
96 0.55
97 0.61
98 0.69
99 0.76
100 0.79
101 0.82
102 0.82
103 0.87
104 0.83
105 0.82
106 0.75
107 0.69
108 0.63
109 0.53
110 0.53
111 0.43
112 0.38