Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IC03

Protein Details
Accession A0A015IC03   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-126FGRWVHAKRKRLPGLVRRREDEBasic
NLS Segment(s)
PositionSequence
111-123AKRKRLPGLVRRR
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033907  Endolysin_autolysin  
IPR002196  Glyco_hydro_24  
IPR023346  Lysozyme-like_dom_sf  
IPR023347  Lysozyme_dom_sf  
Gene Ontology GO:0030430  C:host cell cytoplasm  
GO:0003796  F:lysozyme activity  
GO:0016998  P:cell wall macromolecule catabolic process  
GO:0042742  P:defense response to bacterium  
GO:0031640  P:killing of cells of another organism  
GO:0009253  P:peptidoglycan catabolic process  
Pfam View protein in Pfam  
PF00959  Phage_lysozyme  
CDD cd00737  lyz_endolysin_autolysin  
Amino Acid Sequences MSLFKENFYDDPVGITTIGYGHNCKANKDSDKIKAPISIKEAEELLRKDLVKFEDYVNKQVPELNSNQFSAVVSFAYNLGCDKLRTSILLKKLKAGDTQGASEEFGRWVHAKRKRLPGLVRRREDERQLFLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.1
4 0.09
5 0.11
6 0.11
7 0.12
8 0.12
9 0.18
10 0.19
11 0.21
12 0.24
13 0.3
14 0.33
15 0.37
16 0.42
17 0.44
18 0.5
19 0.5
20 0.48
21 0.46
22 0.43
23 0.42
24 0.4
25 0.35
26 0.28
27 0.27
28 0.26
29 0.22
30 0.25
31 0.22
32 0.19
33 0.19
34 0.19
35 0.18
36 0.21
37 0.21
38 0.17
39 0.17
40 0.18
41 0.23
42 0.24
43 0.29
44 0.28
45 0.26
46 0.25
47 0.26
48 0.25
49 0.19
50 0.2
51 0.19
52 0.18
53 0.18
54 0.18
55 0.15
56 0.14
57 0.12
58 0.1
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.07
69 0.07
70 0.09
71 0.1
72 0.11
73 0.15
74 0.19
75 0.27
76 0.34
77 0.33
78 0.36
79 0.39
80 0.4
81 0.39
82 0.37
83 0.34
84 0.28
85 0.29
86 0.26
87 0.23
88 0.22
89 0.2
90 0.17
91 0.13
92 0.11
93 0.12
94 0.13
95 0.17
96 0.25
97 0.33
98 0.41
99 0.48
100 0.59
101 0.64
102 0.7
103 0.75
104 0.77
105 0.8
106 0.82
107 0.81
108 0.75
109 0.74
110 0.72
111 0.72
112 0.68
113 0.65