Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KBF2

Protein Details
Accession A0A015KBF2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-70RWFSASWTLRKRKQREKFQAVIHDIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGHTIKLSVKWQHKYQTLRVKIVLNSFTLSQFNKFWTTDLEGIPVRWFSASWTLRKRKQREKFQAVIHDIPEEMTMATL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.68
4 0.65
5 0.62
6 0.59
7 0.55
8 0.5
9 0.49
10 0.41
11 0.31
12 0.26
13 0.23
14 0.21
15 0.2
16 0.18
17 0.15
18 0.15
19 0.16
20 0.17
21 0.16
22 0.16
23 0.16
24 0.18
25 0.18
26 0.17
27 0.18
28 0.15
29 0.16
30 0.16
31 0.13
32 0.1
33 0.08
34 0.08
35 0.07
36 0.16
37 0.19
38 0.24
39 0.34
40 0.42
41 0.5
42 0.59
43 0.67
44 0.68
45 0.76
46 0.81
47 0.83
48 0.84
49 0.83
50 0.81
51 0.81
52 0.76
53 0.69
54 0.58
55 0.48
56 0.39
57 0.33
58 0.26
59 0.17