Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015M7E4

Protein Details
Accession A0A015M7E4    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-88ITTLARRDYRKDKNKSIDNEKITHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14, nucl 12, cyto 10, mito 5
Family & Domain DBs
Amino Acid Sequences MIQPKRISQDMLEGLFGTIRELGKDSFTQTLKSYRHSLNKYQVTRLVTSEVKSFNYGDADGTGTGITTLARRDYRKDKNKSIDNEKITV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.12
5 0.1
6 0.09
7 0.09
8 0.11
9 0.11
10 0.13
11 0.13
12 0.15
13 0.18
14 0.18
15 0.2
16 0.2
17 0.27
18 0.26
19 0.29
20 0.32
21 0.32
22 0.4
23 0.42
24 0.46
25 0.48
26 0.55
27 0.53
28 0.5
29 0.49
30 0.43
31 0.39
32 0.34
33 0.28
34 0.21
35 0.2
36 0.21
37 0.18
38 0.17
39 0.17
40 0.16
41 0.13
42 0.14
43 0.13
44 0.1
45 0.1
46 0.1
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.11
57 0.16
58 0.18
59 0.26
60 0.36
61 0.46
62 0.56
63 0.64
64 0.69
65 0.75
66 0.82
67 0.84
68 0.83
69 0.82