Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JGY1

Protein Details
Accession A0A015JGY1    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
24-48IIEHKEIKKSPRKIPNRNRQGRPIFHydrophilic
NLS Segment(s)
PositionSequence
30-45IKKSPRKIPNRNRQGR
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MDIPFNYDTSMLLKHLVTKTGSNIIEHKEIKKSPRKIPNRNRQGRPIFIKPAYKQLIVRFDQQSAFDYFMQENYWSLEIENFVVRILLGNQDNPEYKKQDPGYLQNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.22
5 0.22
6 0.24
7 0.29
8 0.3
9 0.25
10 0.27
11 0.27
12 0.32
13 0.33
14 0.32
15 0.31
16 0.34
17 0.41
18 0.48
19 0.51
20 0.54
21 0.62
22 0.7
23 0.75
24 0.82
25 0.85
26 0.86
27 0.89
28 0.84
29 0.83
30 0.78
31 0.74
32 0.7
33 0.64
34 0.58
35 0.52
36 0.53
37 0.44
38 0.47
39 0.43
40 0.38
41 0.34
42 0.32
43 0.36
44 0.32
45 0.36
46 0.29
47 0.28
48 0.27
49 0.26
50 0.24
51 0.19
52 0.19
53 0.14
54 0.15
55 0.13
56 0.13
57 0.13
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.11
75 0.11
76 0.13
77 0.15
78 0.18
79 0.22
80 0.24
81 0.29
82 0.29
83 0.29
84 0.36
85 0.37
86 0.42
87 0.44
88 0.51