Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IYV1

Protein Details
Accession A0A015IYV1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-28KCSGRRCSGRRYGRNGVRKMBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MNKNVNSVKCSGRRCSGRRYGRNGVRKMILRSGKFYYPSRVAPITTRLFFDDSLLVRRISLDDSLLVRRFSVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.66
4 0.69
5 0.72
6 0.75
7 0.76
8 0.76
9 0.81
10 0.75
11 0.68
12 0.63
13 0.59
14 0.53
15 0.51
16 0.48
17 0.4
18 0.4
19 0.4
20 0.37
21 0.36
22 0.35
23 0.31
24 0.28
25 0.28
26 0.27
27 0.25
28 0.23
29 0.21
30 0.26
31 0.26
32 0.23
33 0.23
34 0.22
35 0.22
36 0.21
37 0.21
38 0.18
39 0.16
40 0.19
41 0.19
42 0.17
43 0.16
44 0.16
45 0.16
46 0.14
47 0.14
48 0.11
49 0.12
50 0.15
51 0.21
52 0.23
53 0.22