Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LCK9

Protein Details
Accession A0A015LCK9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-56LDTHDLKTKEKKKEDKREKKRVKNKEEAVDBasic
NLS Segment(s)
PositionSequence
34-51TKEKKKEDKREKKRVKNK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MPAQLSTILYVSDYKERKAIFLWVPLLDTHDLKTKEKKKEDKREKKRVKNKEEAVDESLIDQVDQVRTDLNELQNVIGNQIPEQENQLFEKIFDILNLIEEFEAGKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.25
4 0.26
5 0.26
6 0.3
7 0.24
8 0.28
9 0.29
10 0.25
11 0.25
12 0.24
13 0.25
14 0.21
15 0.18
16 0.15
17 0.19
18 0.21
19 0.23
20 0.33
21 0.38
22 0.46
23 0.55
24 0.63
25 0.67
26 0.76
27 0.85
28 0.87
29 0.89
30 0.92
31 0.93
32 0.94
33 0.93
34 0.92
35 0.89
36 0.88
37 0.83
38 0.79
39 0.72
40 0.64
41 0.57
42 0.47
43 0.38
44 0.28
45 0.23
46 0.15
47 0.11
48 0.08
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.09
56 0.12
57 0.12
58 0.13
59 0.13
60 0.13
61 0.15
62 0.15
63 0.14
64 0.12
65 0.11
66 0.1
67 0.14
68 0.14
69 0.12
70 0.16
71 0.16
72 0.17
73 0.19
74 0.21
75 0.17
76 0.16
77 0.16
78 0.13
79 0.12
80 0.11
81 0.11
82 0.09
83 0.12
84 0.12
85 0.11
86 0.1
87 0.1