Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LZ59

Protein Details
Accession A0A015LZ59   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-45CLLPWLFKKKKETSKRKKKHLILDDGEHydrophilic
50-73EENKITPPSKQKKKTSVPKESNLDHydrophilic
NLS Segment(s)
PositionSequence
26-37KKKKETSKRKKK
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
Amino Acid Sequences MNYHINQEKGIGAALIRFCLLPWLFKKKKETSKRKKKHLILDDGEESISEENKITPPSKQKKKTSVPKESNLDEIDLMKGEIHKKLKEKHGCDIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.09
6 0.15
7 0.15
8 0.17
9 0.21
10 0.31
11 0.35
12 0.4
13 0.49
14 0.52
15 0.62
16 0.68
17 0.75
18 0.76
19 0.84
20 0.88
21 0.91
22 0.92
23 0.89
24 0.88
25 0.85
26 0.83
27 0.75
28 0.69
29 0.6
30 0.5
31 0.42
32 0.31
33 0.23
34 0.14
35 0.11
36 0.06
37 0.05
38 0.05
39 0.07
40 0.09
41 0.09
42 0.12
43 0.23
44 0.33
45 0.43
46 0.52
47 0.58
48 0.66
49 0.76
50 0.83
51 0.83
52 0.84
53 0.81
54 0.81
55 0.79
56 0.7
57 0.65
58 0.55
59 0.46
60 0.35
61 0.29
62 0.21
63 0.16
64 0.14
65 0.1
66 0.12
67 0.13
68 0.19
69 0.24
70 0.28
71 0.36
72 0.43
73 0.53
74 0.61
75 0.63