Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LJ69

Protein Details
Accession A0A015LJ69   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-47TVEKLRKKPRILKIKRVQRCKTBasic
90-114DEYHNDEYENKKRKNKKNKKSKKRRBasic
NLS Segment(s)
PositionSequence
31-40RKKPRILKIK
100-114KKRKNKKNKKSKKRR
Subcellular Location(s) nucl 23, mito_nucl 13.333, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MSIHIYKTWWRSSALQHLLHDRIDLTVEKLRKKPRILKIKRVQRCKTTTSMPPVDTPNWCLTDKALKRFNRSTNEIPTYDYNTDKDEESDEYHNDEYENKKRKNKKNKKSKKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.45
4 0.49
5 0.47
6 0.44
7 0.37
8 0.27
9 0.2
10 0.18
11 0.16
12 0.14
13 0.17
14 0.21
15 0.26
16 0.32
17 0.4
18 0.45
19 0.52
20 0.58
21 0.62
22 0.7
23 0.73
24 0.77
25 0.79
26 0.83
27 0.83
28 0.84
29 0.8
30 0.77
31 0.74
32 0.67
33 0.61
34 0.56
35 0.53
36 0.5
37 0.48
38 0.4
39 0.38
40 0.36
41 0.34
42 0.29
43 0.27
44 0.22
45 0.21
46 0.2
47 0.18
48 0.16
49 0.24
50 0.27
51 0.31
52 0.36
53 0.36
54 0.42
55 0.49
56 0.54
57 0.51
58 0.55
59 0.53
60 0.53
61 0.55
62 0.49
63 0.45
64 0.41
65 0.4
66 0.35
67 0.31
68 0.24
69 0.22
70 0.23
71 0.21
72 0.19
73 0.16
74 0.16
75 0.18
76 0.2
77 0.19
78 0.21
79 0.2
80 0.2
81 0.18
82 0.2
83 0.24
84 0.31
85 0.4
86 0.44
87 0.53
88 0.63
89 0.74
90 0.82
91 0.86
92 0.87
93 0.89
94 0.93