Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KXX9

Protein Details
Accession A0A015KXX9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPLQTPFRRKCKKNKKLKQKAETADFIHydrophilic
52-71VSKPKPTPIAKVKKNKKDKDBasic
NLS Segment(s)
PositionSequence
9-18RKCKKNKKLK
56-68KPTPIAKVKKNKK
Subcellular Location(s) nucl 12, cyto_nucl 9.833, mito 8.5, cyto_mito 7.666, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPLQTPFRRKCKKNKKLKQKAETADFINKAFLDQKKLFLQSSLEDLEVSGSVSKPKPTPIAKVKKNKKDKDIEEEAMYIITGYQLTGLVLANVNDIIIYDIPLTWKNVELLHHLEVWNKVIFIKVIWKINQLCRQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.95
5 0.93
6 0.92
7 0.9
8 0.85
9 0.78
10 0.72
11 0.67
12 0.58
13 0.49
14 0.4
15 0.31
16 0.26
17 0.27
18 0.24
19 0.25
20 0.24
21 0.29
22 0.31
23 0.33
24 0.32
25 0.28
26 0.27
27 0.2
28 0.23
29 0.2
30 0.16
31 0.13
32 0.13
33 0.12
34 0.1
35 0.09
36 0.06
37 0.05
38 0.08
39 0.09
40 0.11
41 0.12
42 0.14
43 0.2
44 0.22
45 0.29
46 0.37
47 0.46
48 0.52
49 0.62
50 0.7
51 0.73
52 0.82
53 0.79
54 0.77
55 0.76
56 0.71
57 0.69
58 0.66
59 0.58
60 0.48
61 0.43
62 0.35
63 0.26
64 0.22
65 0.13
66 0.06
67 0.05
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.07
89 0.09
90 0.11
91 0.1
92 0.11
93 0.12
94 0.13
95 0.15
96 0.18
97 0.21
98 0.21
99 0.22
100 0.21
101 0.23
102 0.23
103 0.24
104 0.21
105 0.17
106 0.15
107 0.15
108 0.15
109 0.13
110 0.2
111 0.22
112 0.28
113 0.3
114 0.37
115 0.41
116 0.5