Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015NFY9

Protein Details
Accession A0A015NFY9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-73KVSICNKPKKKDKVPSLKPNKQNNNQLKAHydrophilic
NLS Segment(s)
PositionSequence
52-62PKKKDKVPSLK
Subcellular Location(s) mito 14.5, mito_nucl 12.999, nucl 10, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MQCGASAFKVIQTSKGRRKLVGYFKNWETTLKALNAAPVTLPSGKVSICNKPKKKDKVPSLKPNKQNNNQLKASHVQKKAKNTLKSKDHDKDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.58
4 0.55
5 0.59
6 0.6
7 0.63
8 0.62
9 0.58
10 0.55
11 0.55
12 0.58
13 0.53
14 0.46
15 0.37
16 0.3
17 0.28
18 0.22
19 0.22
20 0.17
21 0.19
22 0.17
23 0.15
24 0.12
25 0.09
26 0.11
27 0.09
28 0.1
29 0.08
30 0.08
31 0.08
32 0.12
33 0.14
34 0.21
35 0.29
36 0.38
37 0.44
38 0.51
39 0.61
40 0.67
41 0.74
42 0.76
43 0.78
44 0.79
45 0.84
46 0.87
47 0.88
48 0.87
49 0.87
50 0.87
51 0.87
52 0.84
53 0.84
54 0.83
55 0.79
56 0.74
57 0.65
58 0.59
59 0.56
60 0.55
61 0.54
62 0.53
63 0.54
64 0.56
65 0.65
66 0.71
67 0.73
68 0.75
69 0.74
70 0.76
71 0.77
72 0.78
73 0.79