Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LBP6

Protein Details
Accession A0A015LBP6    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
89-134HWAKDCRSSRRERRRSRSPRRRSRSRSRSRSPRRSLTPRRDRDDRDBasic
NLS Segment(s)
PositionSequence
97-128SRRERRRSRSPRRRSRSRSRSRSPRRSLTPRR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50102  RRM  
PS50158  ZF_CCHC  
Amino Acid Sequences MALFIGRLSLDTHPRDLEHIFDKYGRLNRLEVKRGYAFVEYQDERDASDAMKETDGLRVRGNRIVVEWAKNGGRKPAENQCFKCGREGHWAKDCRSSRRERRRSRSPRRRSRSRSRSRSPRRSLTPRRDRDDRDDRYYRRYSDDERDKRHSHEDRRYSTDRSSSERGQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.27
4 0.27
5 0.25
6 0.24
7 0.24
8 0.23
9 0.24
10 0.28
11 0.33
12 0.32
13 0.29
14 0.31
15 0.38
16 0.44
17 0.5
18 0.45
19 0.45
20 0.43
21 0.42
22 0.41
23 0.34
24 0.27
25 0.22
26 0.28
27 0.23
28 0.22
29 0.23
30 0.2
31 0.19
32 0.19
33 0.17
34 0.1
35 0.11
36 0.11
37 0.1
38 0.1
39 0.11
40 0.1
41 0.16
42 0.18
43 0.17
44 0.19
45 0.21
46 0.23
47 0.25
48 0.25
49 0.2
50 0.18
51 0.23
52 0.22
53 0.21
54 0.2
55 0.19
56 0.2
57 0.22
58 0.22
59 0.21
60 0.21
61 0.2
62 0.24
63 0.31
64 0.36
65 0.42
66 0.43
67 0.44
68 0.46
69 0.45
70 0.46
71 0.37
72 0.33
73 0.37
74 0.38
75 0.37
76 0.41
77 0.44
78 0.4
79 0.48
80 0.49
81 0.44
82 0.47
83 0.53
84 0.56
85 0.64
86 0.73
87 0.74
88 0.8
89 0.85
90 0.9
91 0.91
92 0.92
93 0.91
94 0.92
95 0.91
96 0.93
97 0.91
98 0.91
99 0.91
100 0.91
101 0.9
102 0.89
103 0.91
104 0.91
105 0.93
106 0.9
107 0.88
108 0.86
109 0.87
110 0.87
111 0.87
112 0.87
113 0.85
114 0.83
115 0.82
116 0.78
117 0.77
118 0.77
119 0.73
120 0.71
121 0.71
122 0.67
123 0.66
124 0.67
125 0.59
126 0.54
127 0.52
128 0.5
129 0.51
130 0.6
131 0.61
132 0.63
133 0.69
134 0.66
135 0.66
136 0.7
137 0.69
138 0.68
139 0.69
140 0.72
141 0.7
142 0.75
143 0.76
144 0.7
145 0.65
146 0.63
147 0.56
148 0.54
149 0.54