Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015MVT4

Protein Details
Accession A0A015MVT4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSQNKKKSSNKRKLHKASKKVNRNRISTTHydrophilic
NLS Segment(s)
PositionSequence
5-23KKKSSNKRKLHKASKKVNR
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MSQNKKKSSNKRKLHKASKKVNRNRISTTPNTRQTSTTPSTGQTSTTPNTGQISTTPNTGQTSTPKKVDILIVLHYSIPLFKGVSFILTISKKFINTETNQYEKSAASKDKLSDDVEIIKVVREQISTTATGQVYQKNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.92
4 0.93
5 0.93
6 0.93
7 0.92
8 0.92
9 0.88
10 0.83
11 0.8
12 0.77
13 0.73
14 0.71
15 0.7
16 0.69
17 0.7
18 0.68
19 0.63
20 0.57
21 0.52
22 0.51
23 0.45
24 0.39
25 0.31
26 0.29
27 0.31
28 0.29
29 0.28
30 0.22
31 0.22
32 0.2
33 0.21
34 0.19
35 0.17
36 0.19
37 0.17
38 0.16
39 0.13
40 0.16
41 0.15
42 0.16
43 0.15
44 0.15
45 0.15
46 0.16
47 0.16
48 0.18
49 0.25
50 0.26
51 0.27
52 0.26
53 0.25
54 0.25
55 0.24
56 0.19
57 0.14
58 0.13
59 0.13
60 0.12
61 0.12
62 0.11
63 0.1
64 0.08
65 0.07
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.11
75 0.12
76 0.13
77 0.14
78 0.15
79 0.15
80 0.16
81 0.18
82 0.2
83 0.21
84 0.3
85 0.32
86 0.35
87 0.36
88 0.35
89 0.34
90 0.28
91 0.28
92 0.25
93 0.22
94 0.21
95 0.24
96 0.25
97 0.27
98 0.29
99 0.28
100 0.24
101 0.24
102 0.25
103 0.22
104 0.21
105 0.18
106 0.16
107 0.15
108 0.16
109 0.15
110 0.12
111 0.13
112 0.15
113 0.18
114 0.18
115 0.18
116 0.22
117 0.21
118 0.23
119 0.24