Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015ISH2

Protein Details
Accession A0A015ISH2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-41LENAKVYQKYPNRTRRKKNYNPNTQTMEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNTLRLRKERRLLLENAKVYQKYPNRTRRKKNYNPNTQTMENINEKEIKIMELYTPKIMYEYKEMTEEKEKQVKEWLEKTREAEEYEYKLRILKGLDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.64
3 0.58
4 0.55
5 0.47
6 0.42
7 0.44
8 0.42
9 0.42
10 0.49
11 0.57
12 0.63
13 0.73
14 0.83
15 0.85
16 0.9
17 0.91
18 0.92
19 0.92
20 0.92
21 0.88
22 0.84
23 0.78
24 0.68
25 0.6
26 0.51
27 0.44
28 0.35
29 0.3
30 0.24
31 0.2
32 0.19
33 0.18
34 0.16
35 0.12
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.12
43 0.11
44 0.12
45 0.12
46 0.12
47 0.15
48 0.16
49 0.16
50 0.2
51 0.2
52 0.22
53 0.29
54 0.3
55 0.31
56 0.36
57 0.35
58 0.33
59 0.41
60 0.42
61 0.41
62 0.46
63 0.49
64 0.47
65 0.5
66 0.52
67 0.49
68 0.47
69 0.43
70 0.39
71 0.35
72 0.36
73 0.37
74 0.35
75 0.3
76 0.31
77 0.29
78 0.28