Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LD63

Protein Details
Accession A0A015LD63    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-53YKKYNNQKSTPRERIRLTKKKNKCSSQKTHNKRFFVRKSKKEKEEGKETQKHydrophilic
NLS Segment(s)
PositionSequence
14-48RERIRLTKKKNKCSSQKTHNKRFFVRKSKKEKEEG
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MVYKKYNNQKSTPRERIRLTKKKNKCSSQKTHNKRFFVRKSKKEKEEGKETQKLSQRAVRVASEFFLQNRELREEIIQLRQEVQELQEEVQVREDFSIIKFSQESQVRQELQQQVQQLQQQLSSLQEQLQEASSRDELVEQQQAPLPLTNSEQYQLVAENEIMLNDIQERDDFIQRLKNERVNEHLAFCRQISALKEDCNRLRRERNAAHHRAEGMIVLLRNRDNSRNPPSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.82
4 0.83
5 0.84
6 0.84
7 0.83
8 0.85
9 0.88
10 0.91
11 0.91
12 0.9
13 0.9
14 0.9
15 0.91
16 0.91
17 0.91
18 0.92
19 0.9
20 0.87
21 0.85
22 0.85
23 0.84
24 0.84
25 0.85
26 0.84
27 0.86
28 0.89
29 0.88
30 0.87
31 0.86
32 0.83
33 0.83
34 0.82
35 0.8
36 0.77
37 0.7
38 0.68
39 0.66
40 0.6
41 0.54
42 0.49
43 0.43
44 0.39
45 0.4
46 0.35
47 0.3
48 0.28
49 0.24
50 0.21
51 0.19
52 0.16
53 0.16
54 0.15
55 0.15
56 0.16
57 0.19
58 0.17
59 0.17
60 0.18
61 0.19
62 0.2
63 0.23
64 0.22
65 0.2
66 0.21
67 0.2
68 0.2
69 0.16
70 0.15
71 0.13
72 0.12
73 0.12
74 0.13
75 0.14
76 0.14
77 0.17
78 0.16
79 0.13
80 0.12
81 0.12
82 0.1
83 0.09
84 0.14
85 0.1
86 0.11
87 0.11
88 0.12
89 0.18
90 0.21
91 0.22
92 0.21
93 0.26
94 0.26
95 0.26
96 0.32
97 0.3
98 0.28
99 0.29
100 0.27
101 0.23
102 0.25
103 0.26
104 0.22
105 0.17
106 0.15
107 0.13
108 0.13
109 0.12
110 0.11
111 0.1
112 0.08
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.12
120 0.11
121 0.1
122 0.1
123 0.1
124 0.09
125 0.11
126 0.15
127 0.12
128 0.13
129 0.14
130 0.15
131 0.15
132 0.15
133 0.14
134 0.1
135 0.12
136 0.13
137 0.12
138 0.12
139 0.11
140 0.11
141 0.11
142 0.1
143 0.09
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.08
157 0.1
158 0.14
159 0.15
160 0.15
161 0.22
162 0.23
163 0.3
164 0.33
165 0.36
166 0.35
167 0.38
168 0.42
169 0.43
170 0.43
171 0.4
172 0.38
173 0.35
174 0.33
175 0.3
176 0.26
177 0.2
178 0.22
179 0.21
180 0.23
181 0.24
182 0.28
183 0.32
184 0.38
185 0.44
186 0.48
187 0.51
188 0.53
189 0.59
190 0.6
191 0.66
192 0.68
193 0.72
194 0.76
195 0.78
196 0.74
197 0.69
198 0.63
199 0.54
200 0.45
201 0.35
202 0.26
203 0.21
204 0.18
205 0.16
206 0.17
207 0.18
208 0.23
209 0.26
210 0.31
211 0.35
212 0.42
213 0.51